SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1j55_A from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1j55_A
Domain Number 1 Region: 1-91
Classification Level Classification E-value
Superfamily EF-hand 1.15e-23
Family S100 proteins 0.0000611
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 1j55_A
Sequence length 95
Comment mol:protein length:95 S-100P PROTEIN
Sequence
MTELETAMGMIIDVFSRYSGSEGSTQTLTKGELKVLMEKELPGFLQSGKDKDAVDKLLKD
LDANGDAQVDFSEFIVFVAAITSACHKYFEKAGLK
Download sequence
Identical sequences A0A096NZC3 A0A0D9RU76 A0A2K5KB38 A0A2K5NID4 A0A2K5VYQ1 A0A2K5XH25 A0A2K6DNK8 A0A2K6L7L3 F6PWQ7 H2PCU7 P25815
OPTIC300 ENSPPYP00000016292 gi|5174663|ref|NP_005971.1| ENSPANP00000018444 ENSP00000296370 ENSP00000296370 NP_005971.1.87134 NP_005971.1.92137 XP_002814597.1.23681 XP_008016168.1.81039 cath|current|1j55A00/1-94 ENSPPYP00000016292 9600.ENSPPYP00000016292 9606.ENSP00000296370 ENSP00000296370 1j55A 1j55_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]