SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1juo_A from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1juo_A
Domain Number 1 Region: 33-197
Classification Level Classification E-value
Superfamily EF-hand 7.57e-47
Family Penta-EF-hand proteins 0.000000332
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 1juo_A
Sequence length 198
Comment mol:protein length:198 sorcin
Sequence
MAYPGHPGAGGGYYPGGYGGAPGGPAFPGQTQDPLYGYFAAVAGQDGQIDADELQRCLTQ
SGIAGGYKPFNLETCRLMVSMLDRDMSGTMGFNEFKELWAVLNGWRQHFISFDTDRSGTV
DPQELQKALTTMGFRLSPQAVNSIAKRYSTNGKITFDDYIACCVKLRALTDSFRRRDTAQ
QGVVNFPYDDFIQCVMSV
Download sequence
Identical sequences A0A2J8WK94 H2QUW0 P30626 Q5R4U9
ENSP00000265729 NP_001127644.1.23681 NP_003121.1.87134 NP_003121.1.92137 XP_001164490.1.37143 XP_003822767.1.60992 9600.ENSPPYP00000019992 9606.ENSP00000265729 ENSPTRP00000033143 1juoA 1juo_A 1juo_B 4u8d_A 4u8d_B 4usl_A gi|4507207|ref|NP_003121.1| ENSPTRP00000033143 ENSP00000265729 ENSPPYP00000019992 ENSPPYP00000019992 ENSP00000265729

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]