SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1kdg_A from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1kdg_A
Domain Number 1 Region: 6-287,480-541
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.85e-55
Family FAD-linked reductases, N-terminal domain 0.000000000104
Further Details:      
 
Domain Number 2 Region: 304-484
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 9e-55
Family GMC oxidoreductases 0.00000000701
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 1kdg_A
Sequence length 546
Comment mol:protein length:546 cellobiose dehydrogenase
Sequence
ptvsatpydyiivgagpggiiaadrlseagkkvlllerggpstkqtggtyvapwatssgl
tkfdipglfeslftdsnpfwwckditvfagclvgggtsvngalywypndgdfsssvgwps
swtnhapytsklssrlpstdhpstdgqryleqsfnvvsqllkgqgynqatindnpnykdh
vfgysafdflngkragpvatylqtalarpnftfktnvmvsnvvrngsqilgvqtndptlg
pngfipvtpkgrvilsagafgtsrilfqsgigptdmiqtvqsnptaaaalppqnqwinlp
vgmnaqdnpsinlvfthpsidayenwadvwsnprpadaaqylanqsgvfagaspklnfwr
aysgsdgftryaqgtvrpgaasvnsslpynasqiftitvylstgiqsrgrigidaalrgt
vltppwlvnpvdktvllqalhdvvsnigsipgltmitpdvtqtleeyvdaydpatmnsnh
wvssttigsspqsavvdsnvkvfgtnnlfivdagiiphlptgnpqgtlmsaaeqaaakil
alaggp
Download sequence
Identical sequences 1kdg_A 1kdg_B 1kdgA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]