SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1lbh_A from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1lbh_A
Domain Number 1 Region: 63-329
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 7.62e-75
Family L-arabinose binding protein-like 0.00000000193
Further Details:      
 
Domain Number 2 Region: 4-49
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 1.04e-24
Family GalR/LacI-like bacterial regulator 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 1lbh_A
Sequence length 360
Comment mol:protein length:360 INTACT LACTOSE OPERON REPRESSOR WITH GRATUITOUS INDUCER IPTG
Sequence
mkpvtlydvaeyagvsyqtvsrvvnqashvsaktrekveaamaelnyipnrvaqqlagkq
slligvatsslalhapsqivaaiksradqlgasvvvsmversgveacktavhnllaqrvs
gliinyplddqdaiaveaactnvpalfldvsdqtpinsiifshedgtrlgvehlvalghq
qiallagplssvsarlrlagwhkyltrnqiqpiaeregdwsamsgfqqtmqmlnegivpt
amlvandqmalgamraitesglrvgadisvvgyddtedsscyipplttikqdfrllgqts
vdrllqlsqgqavkgnqllpvslvkrkttlapntqtaspraladslmqlarqvsrlesgq
Download sequence
Identical sequences A0A0E1L3W2
1lbg_A 1lbg_B 1lbg_C 1lbg_D 1lbh_A 1lbh_B 1lbh_C 1lbh_D 1lbi_A 1lbi_B 1lbi_C 1lbi_D 1lbiA WP_071925347.1.75758

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]