SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1naa_B from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1naa_B
Domain Number 1 Region: 2-282,475-536
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 6.21e-55
Family FAD-linked reductases, N-terminal domain 0.000000000104
Further Details:      
 
Domain Number 2 Region: 299-479
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 8.78e-55
Family GMC oxidoreductases 0.00000000701
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 1naa_B
Sequence length 541
Comment mol:protein length:541 Cellobiose dehydrogenase
Sequence
tpydyiivgagpggiiaadrlseagkkvlllerggpstkqtggtyvapwatssgltkfdi
pglfeslftdsnpfwwckditvfagclvgggtsvngalywypndgdfsssvgwpsswtnh
apytsklssrlpstdhpstdgqryleqsfnvvsqllkgqgynqatindnpnykdhvfgys
afdflngkragpvatylqtalarpnftfktnvmvsnvvrngsqilgvqtndptlgpngfi
pvtpkgrvilsagafgtsrilfqsgigptdmiqtvqsnptaaaalppqnqwinlpvgmna
qdnpsinlvfthpsidayenwadvwsnprpadaaqylanqsgvfagaspklnfwraysgs
dgftryaqgtvrpgaasvnsslpynasqiftitvylstgiqsrgrigidaalrgtvltpp
wlvnpvdktvllqalhdvvsnigsipgltmitpdvtqtleeyvdaydpatmnsnhwvsst
tigsspqsavvdsnvkvfgtnnlfivdagiiphlptgnpqgtlmsaaeqaaakilalagg
p
Download sequence
Identical sequences 1naa_A 1naa_B 1naaA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]