SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1o95_A from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1o95_A
Domain Number 1 Region: 3-338
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 5.1e-88
Family FMN-linked oxidoreductases 0.0000000000386
Further Details:      
 
Domain Number 2 Region: 342-532
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 3.69e-28
Family N-terminal domain of adrenodoxin reductase-like 0.000000125
Further Details:      
 
Domain Number 3 Region: 495-675
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.81e-27
Family C-terminal domain of adrenodoxin reductase-like 0.000000443
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 1o95_A
Sequence length 729
Comment mol:protein length:729 TRIMETHYLAMINE DEHYDROGENASE
Sequence
ardpkhdilfepiqigpktlrnrfyqvphcigagsdkpgfqsahrsvkaeggwaalntey
csinpesddthrlsariwdegdvrnlkamtdevhkygalagvelwyggahapnmesratp
rgpsqyasefetlsyckemdlsdiaqvqqfyvdaakrsrdagfdivyvygahsylplqfl
npyynkrtdkyggslenrarfwletlekvkhavgsdcaiatrfgvdtvygpgqieaevdg
qkfvemadslvdmwditigdiaewgedagpsrfyqqghtipwvklvkqvskkpvlgvgry
tdpekmieivtkgyadiigcarpsiadpflpqkveqgryddirvcigcnvcisrweiggp
pmictqnatageeyrrgwhpekfrqtknkdsvlivgagpsgseaarvlmesgytvhltdt
aekigghlnqvaalpglgewsyhrdyretqitkllkknkesqlalgqkpmtaddvlqyga
dkviiatgarwntdgtnclthdpipgadaslpdqltpeqvmdgkkkigkrvvilnadtyf
mapslaeklataghevtivsgvhlanymhftleypnmmrrlhelhveelgdhfcsriepg
rmeiyniwgdgskrtyrgpgvsprdantshrwiefdslvlvtgrhsectlwnelkarese
waendikgiyligdaeaprliadatftghrvareieeanpqiaipykretiawgtphmpg
gnfkieykv
Download sequence
Identical sequences 1djn_A 1djn_B 1o94_A 1o94_B 1o95_A 1o95_B 2tmd_A 2tmd_B 1djnA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]