SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1ps9_A from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1ps9_A
Domain Number 1 Region: 2-361
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 1.18e-108
Family FMN-linked oxidoreductases 0.000000000223
Further Details:      
 
Domain Number 2 Region: 332-518
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 8.56e-42
Family N-terminal domain of adrenodoxin reductase-like 0.0000003
Further Details:      
 
Domain Number 3 Region: 466-626
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.47e-27
Family C-terminal domain of adrenodoxin reductase-like 0.0000000583
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 1ps9_A
Sequence length 671
Comment mol:protein length:671 2,4-dienoyl-CoA reductase
Sequence
sypslfapldlgfttlknrvlmgsmhtgleeypdgaerlaafyaerarhgvalivsggia
pdltgvgmeggamlndasqiphhrtiteavhqeggkialqilhtgrysyqphlvapsalq
apinrfvphelsheeilqlidnfarcaqlareagydgvevmgsegylinefltlrtnqrs
dqwggdyrnrmrfavevvravrervgndfiiiyrlsmldlvedggtfaetvelaqaieaa
gatiintgigwheariptiatpvprgafswvtrklkghvslplvttnrindpqvaddils
rgdadmvsmarpfladaellskaqsgradeintcigcnqacldqifvgkvtsclvnprac
hetkmpilpavqkknlavvgagpaglafainaaarghqvtlfdahseiggqfniakqipg
keefyetlryyrrmievtgvtlklnhtvtadqlqafdetilasgivprtppidgidhpkv
lsyldvlrdkapvgnkvaiigcggigfdtamylsqpgestsqniagfcnewgidsslqqa
gglspqgmqiprsprqivmlqrkaskpgqglgkttgwihrttllsrgvkmipgvsyqkid
ddglhvvingetqvlavdnvvicagqepnralaqplidsgktvhliggcdvameldarra
iaqgtrlalei
Download sequence
Identical sequences 1ps9_A 1ps9A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]