SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1sxi_L from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1sxi_L
Domain Number 1 Region: 10-279
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.98e-121
Family L-arabinose binding protein-like 0.0000245
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 1sxi_L
Sequence length 280
Comment mol:protein length:280 Glucose-resistance amylase regulator
Sequence
rglaskktttvgviipdisnifyaelargiediatmykyniilsnsdqnqdkelhllnnm
lgkqvdgiifmsgnvteehveelkkspvpvvlaasiestnqipsvtidyeqaafdavqsl
idsghkniafvsgtleepinhakkvkgykraltesglpvrdsyivegdytydsgieavek
lleedekptaifvgtdemalgvihgaqdrglnvpndleiigfdntrlstmvrpqltsvvq
pmydigavamrlltkymnketvdssivqlphriefrqstk
Download sequence
Identical sequences 1sxg_A 1sxg_B 1sxg_D 1sxg_F 1sxg_I 1sxg_P 1sxh_A 1sxh_D 1sxi_A 1sxi_B 1sxi_D 1sxi_G 1sxi_I 1sxi_K 1sxi_L 1sxi_M 1sxi_N 1sxi_R 1sxi_T 1sxi_W 2nzu_G 2nzv_G 2oen_G 2nzuG

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]