SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2cpq_A from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2cpq_A
Domain Number 1 Region: 12-80
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000117
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000396
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 2cpq_A
Sequence length 91
Comment mol:protein length:91 Fragile X mental retardation syndrome related protein 1, isoform b'
Sequence
gssgssgtkqlaaafheefvvredlmglaigthgsniqqarkvpgvtaieldedtgtfri
ygesadavkkargflefvedfiqvpsgpssg
Download sequence
Identical sequences 2cpq_A 2cpqA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]