SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 2ecs_A from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2ecs_A
Domain Number 1 Region: 1-65
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 7.74e-28
Family Phage repressors 0.0000243
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 2ecs_A
Sequence length 66
Comment mol:protein length:66 Phage lambda Cro
Sequence
meqritlkdyamrfgqtktakdlgvypssinqaihagrkifltinadgsvyaeevkpfps
nkktta
Download sequence
Identical sequences 2ecs_A 2ecs_B 2ovg_A cath|current|2ecsA00/1-60 cath|current|2ecsB00/1-60 cath|current|2ovgA00/3-60

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]