SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 2hsg_A from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2hsg_A
Domain Number 1 Region: 62-331
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 3.66e-121
Family L-arabinose binding protein-like 0.0000245
Further Details:      
 
Domain Number 2 Region: 3-48
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 9.54e-28
Family GalR/LacI-like bacterial regulator 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 2hsg_A
Sequence length 332
Comment mol:protein length:332 Glucose-resistance amylase regulator
Sequence
MNVTIYDVAREASVSMATVSRVVNGNPNVKPSTRKKVLETIERLGYRPNAVARGLASKKT
TTVGVIIPDISNIFYAELARGIEDIATMYKYNIILSNSDQNQDKELHLLNNMLGKQVDGI
IFMSGNVTEEHVEELKKSPVPVVLAASIESTNQIPSVTIDYEQAAFDAVQSLIDSGHKNI
AFVSGTLEEPINHAKKVKGYKRALTESGLPVRDSYIVEGDYTYDSGIEAVEKLLEEDEKP
TAIFVGTDEMALGVIHGAQDRGLNVPNDLEIIGFDNTRLSTMVRPQLTSVVQPMYDIGAV
AMRLLTKYMNKETVDSSIVQLPHRIEFRQSTK
Download sequence
Identical sequences D5DN10 P46828
1rzr_A 1rzr_C 1rzr_D 1rzr_G 2hsg_A 2hsgA WP_013085229.1.11259 gi|295706902|ref|YP_003599977.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]