SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 2iuo_J from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2iuo_J
Domain Number 1 Region: 88-155
Classification Level Classification E-value
Superfamily Cyanase C-terminal domain 9.27e-29
Family Cyanase C-terminal domain 0.024
Further Details:      
 
Domain Number 2 Region: 1-85
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 4.22e-20
Family Cyanase N-terminal domain 0.0000136
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 2iuo_J
Sequence length 156
Comment mol:protein length:156 CYANATE HYDRATASE
Sequence
miqsqinrnirldladaillskakkdlsfaeiadgtglaeafvtaallgqqalpadaarl
vgakldldedsilllqmiplrgciddriptdptmyrfyemlqvygttlkalvhekfgdgi
igainfkldvkkvadpeggeravitldgkylptkpf
Download sequence
Identical sequences 2iuoA 2iuo_A 2iuo_B 2iuo_C 2iuo_D 2iuo_E 2iuo_F 2iuo_G 2iuo_H 2iuo_I 2iuo_J

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]