SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 2ivb_J from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2ivb_J
Domain Number 1 Region: 88-156
Classification Level Classification E-value
Superfamily Cyanase C-terminal domain 4.68e-51
Family Cyanase C-terminal domain 0.024
Further Details:      
 
Domain Number 2 Region: 1-85
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 4.22e-20
Family Cyanase N-terminal domain 0.0000136
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 2ivb_J
Sequence length 156
Comment mol:protein length:156 CYANATE HYDRATASE
Sequence
miqsqinrnirldladaillskakkdlsfaeiadgtglaeafvtaallgqqalpadaarl
vgakldldedsilllqmiplrgciddriptdptmyrfyemlqvygttlkalvhekfgdgi
iaainfkldvkkvadpeggeravitldgkylptkpf
Download sequence
Identical sequences 2ivb_A 2ivb_B 2ivb_C 2ivb_D 2ivb_E 2ivb_F 2ivb_G 2ivb_H 2ivb_I 2ivb_J

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]