SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 2o26_U from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2o26_U
Domain Number 1 Region: 189-286
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000188
Family I set domains 0.061
Further Details:      
 
Domain Number 2 Region: 12-88
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000238
Family SCOPe 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 2o26_U
Sequence length 290
Comment mol:protein length:290 Mast/stem cell growth factor receptor
Sequence
sqpsaspgepsppsihpaqseliveagdtlsltcidpdfvrwtfktyfnemvenkknewi
qekaeatrtgtytcsnsngltssiyvfvrdpaklflvglplfgkedsdalvrcpltdpqv
sqysliecdgkslptdltfvpnpkagitiknvkrayhrlcvrcaaqrdgtwlhsdkftlk
vreaikaipvvsvpetshllkkgdtftvvctikdvstsvnsmwlkmnpqpqhiaqvkhns
whrgdfnyerqetltissarvddsgvfmcyanntfgsanvtttlkvvekg
Download sequence
Identical sequences 2o26_U 2o26_W 2o26_X 2o26_Y

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]