SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3g5g_B from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3g5g_B
Domain Number 1 Region: 28-89
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.00000000000000989
Family SinR domain-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3g5g_B
Sequence length 99
Comment mol:protein length:99 Regulatory protein
Sequence
mgsshhhhhhssglvprgshmesfllskvsfvikkirlekgmtqedlayksnldrtyisg
iernsrnltikslelimkglevsdvvffemlikeilkhd
Download sequence
Identical sequences 3g5g_A 3g5g_B 3g5g_C 3g5g_D 3g5g_E 3g5g_F 3g5g_G 3g5g_H 3g5g_I 3g5g_J 3g5g_K 3g5g_L 3g5g_M 3g5g_N

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]