SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3lbz_A from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3lbz_A
Domain Number 1 Region: 12-124
Classification Level Classification E-value
Superfamily POZ domain 3.25e-34
Family BTB/POZ domain 0.0000121
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3lbz_A
Sequence length 127
Comment mol:protein length:127 B-cell lymphoma 6 protein
Sequence
gsadsqiqftrhasdvllnlnrlrsrdiltdvvivvsreqfrahktvlmacsglfysift
dqlkrnlsvinldpeinpegfnilldfmytsrlnlregnimavmatamylqmehvvdtcr
kfikase
Download sequence
Identical sequences 1r28_A 1r28_B 1r29_A 1r2b_A 1r2b_B 3bim_A 3bim_B 3bim_C 3bim_D 3bim_E 3bim_F 3bim_G 3bim_H 3lbz_A 3lbz_B 1r29A cath|current|1r28A00/7-128 cath|current|1r28B00/7-128 cath|current|1r29A00/7-128 cath|current|1r2bA00/5-129 cath|current|1r2bB00/6-128 cath|current|3bimA00/5-129 cath|current|3bimB00/5-128 cath|current|3bimC00/5-129 cath|current|3bimD00/5-128 cath|current|3bimE00/6-128 cath|current|3bimF00/5-126 cath|current|3bimG00/7-128 cath|current|3bimH00/6-127 cath|current|3lbzA00/7-128 cath|current|3lbzB00/7-128

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]