SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3ro6_E from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3ro6_E
Domain Number 1 Region: 130-351
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 4.21e-69
Family SCOPe 0.0000000278
Further Details:      
 
Domain Number 2 Region: 1-124
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 1.25e-34
Family SCOPe 0.00000492
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3ro6_E
Sequence length 356
Comment mol:protein length:356 Putative chloromuconate cycloisomerase
Sequence
MKIADIQVRTEHFPLTRPYRIAFRSIEEIDNLIVEIRTADGLLGLGAASPERHVTGETLE
ACHAALDHDRLGWLMGRDIRTLPRLCRELAERLPAAPAARAALDMALHDLVAQCLGLPLV
EILGRAHDSLPTSVTIGIKPVEETLAEAREHLALGFRVLKVKLCGDEEQDFERLRRLHET
LAGRAVVRVDPNQSYDRDGLLRLDRLVQELGIEFIEQPFPAGRTDWLRALPKAIRRRIAA
DESLLGPADAFALAAPPAACGIFNIKLMKCGGLAPARRIATIAETAGIDLMWGCMDESRI
SIAAALHAALACPATRYLDLDGSFDLARDVAEGGFILEDGRLRVTERPGLGLVYPD
Download sequence
Identical sequences Q607C7
gi|53803900|ref|YP_114271.1| WP_010961086.1.29143 3rit_A 3rit_B 3rit_C 3rit_D 3rit_E 3ro6_A 3ro6_B 3ro6_C 3ro6_D 3ro6_E 3ro6_F 243233.MCA1834 NYSGXRC-9454d

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]