SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3s8q_A from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3s8q_A
Domain Number 1 Region: 11-72
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.00000000000000527
Family SinR domain-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3s8q_A
Sequence length 82
Comment mol:protein length:82 R-M CONTROLLER PROTEIN
Sequence
gshmesfllskvsfvikkirlekgmtqedlayksnldrtyisgiernsrnltikslelim
kglevsdvvffemlikeilkhd
Download sequence
Identical sequences cath|current|3clcA00/2-77 cath|current|3clcB00/2-78 cath|current|3clcC00/2-78 cath|current|3clcD00/2-77 cath|current|3s8qA00/2-77 cath|current|3s8qB00/3-79 cath|current|3ufdA00/2-77 cath|current|3ufdB00/2-78 cath|current|3ufdE00/2-77 cath|current|3ufdF00/3-78 cath|current|4i6rA00/3-79 cath|current|4i6rB00/3-79 cath|current|4i8tA00/3-77 cath|current|4i8tB00/2-76 cath|current|4iwrA00/2-76 cath|current|4iwrB00/2-77 cath|current|4iwrE00/2-76 cath|current|4iwrF00/2-77 3clc_A 3clc_B 3clc_C 3clc_D 3s8q_A 3s8q_B 3ufd_A 3ufd_B 3ufd_E 3ufd_F 4i6r_A 4i6r_B 4i8t_A 4i8t_B 4iwr_A 4iwr_B 4iwr_E 4iwr_F 4x4b_A 4x4b_B 4x4b_C 4x4b_D 4x4c_A 4x4c_B 4x4c_C 4x4c_D 4x4d_A 4x4d_B 4x4d_C 4x4d_D 4x4e_A 4x4e_B 4x4e_C 4x4e_D 4x4f_A 4x4f_B 4x4f_C 4x4f_D 4x4g_A 4x4g_B 4x4g_C 4x4g_D 4x4h_A 4x4h_B 4x4h_C 4x4h_D 4x4i_A 4x4i_B 4x4i_C 4x4i_D

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]