SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3woa_A from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3woa_A
Domain Number 1 Region: 57-415
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 9.37e-130
Family Phosphate binding protein-like 0.000000000282
Further Details:      
 
Domain Number 2 Region: 3-46
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.00000264
Family Phage repressors 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3woa_A
Sequence length 417
Comment mol:protein length:417 Repressor protein CI, Maltose-binding periplasmic protein
Sequence
MSTKKKPLTQEQLEDARRLKAIYEKKKNELGLSQESVADKMGMGQSGSGMKIEEGKLVIW
INGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGY
AQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWE
EIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKA
GLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTF
KGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEE
LAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALKDAQTN
Download sequence
Identical sequences 3woa_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]