SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3wxx_A from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3wxx_A
Domain Number 1 Region: 17-126
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000137
Family SCOPe 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3wxx_A
Sequence length 151
Comment mol:protein length:151 AcrH
Sequence
NEPAIEAFLQDGGTLAMLNDVSTDTLEQLYTLGFNQYHAGKHDEAHKIFQALCVLDHYEA
RFFLGLGACRQALGQFRLAIDSYSYGAMMDLQEPRFPFHAAECLLQLGELEGAESGFHSA
QLLAAAKPELAELAARAGIMLEVVKTKKDME
Download sequence
Identical sequences 001693550|e3wxxG1|109.4.1.731|G:1-151 001697349|e3wxxE1|109.4.1.731|E:1-151 3wxx_A 3wxx_C 3wxx_E 3wxx_G

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]