SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 4k0r_A from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  4k0r_A
Domain Number 1 Region: 210-490
Classification Level Classification E-value
Superfamily Cryptochrome/photolyase FAD-binding domain 8.05e-154
Family Cryptochrome/photolyase FAD-binding domain 0.000000378
Further Details:      
 
Domain Number 2 Region: 5-201
Classification Level Classification E-value
Superfamily Cryptochrome/photolyase, N-terminal domain 8.05e-79
Family Cryptochrome/photolyase, N-terminal domain 0.0000835
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 4k0r_A
Sequence length 617
Comment mol:protein length:617 Cryptochrome-1
Sequence
mgvnavhwfrkglrlhdnpalkeciqgadtircvyildpwfagssnvginrwrfllqcle
dldanlrklnsrlfvirgqpadvfprlfkewnitklsieydsepfgkerdaaikklatea
gvevivrishtlydldkiielnggqppltykrfqtlvskmeplempadtitsdvigkcmt
plsddhdekygvpsleelgfdtdglssavwpggetealtrlerhlerkawvanferprmn
ansllasptglspylrfgclscrlfyfkltdlykkvkknsspplslygqllwreffytaa
tnnprfdkmegnpicvqipwdknpealakwaegrtgfpwidaimtqlrqegwihhlarha
vacfltrgdlwisweegmkvfeellldadwsinagswmwlscssffqqffhcycpvgfgr
rtdpngdyirrylpvlrgfpakyiydpwnapegiqkvakcligvnypkpmvnhaeasrln
iermkqiyqqlsryrglgllasvpsnsngngglmgyapgenvpscsssgngglmgyapge
nvpscsggncsqgsgilhyahgdsqqthslkqgrssagtglssgkrpsqeedaqsvgpkv
qrqssnaaalehhhhhh
Download sequence
Identical sequences 4k0r_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]