SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 4k3d_I from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  4k3d_I
Domain Number 1 Region: 1-99
Classification Level Classification E-value
Superfamily Immunoglobulin 6.02e-37
Family V set domains (antibody variable domain-like) 0.00011
Further Details:      
 
Domain Number 2 Region: 174-272
Classification Level Classification E-value
Superfamily Immunoglobulin 1.15e-24
Family C1 set domains (antibody constant domain-like) 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 4k3d_I
Sequence length 280
Comment mol:protein length:280 BOVINE ANTIBODY WITH ULTRALONG CDR H3, HEAVY CHAIN
Sequence
evqlresgpslvkpsqtlsltctasgfslsdkavgwvrqapgkalewlgsidtggntgyn
pglksrlsitkdnsksqvslsvssvttedsatyyctsvhqetkkyqscpdgyrersdcsn
rpacgtsdccrvsvfgnclttlpvsysytynyewhvdvwgqgllvtvssasttapkvypl
ssccgdkssstvtlgclvssympepvtvtwnsgalksgvhtfpavlqssglyslssmvtv
pgstsgqtftcnvahpasstkvdkavepkscdgshhhhhh
Download sequence
Identical sequences 4k3d_H 4k3d_I

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]