SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 4opn_B from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  4opn_B
Domain Number 1 Region: 32-175
Classification Level Classification E-value
Superfamily Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase 1.66e-55
Family Glyoxalase I (lactoylglutathione lyase) 0.00000693
Further Details:      
 
Domain Number 2 Region: 40-174
Classification Level Classification E-value
Superfamily PDB 0.0000000000167
Family PDB 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 4opn_B
Sequence length 184
Comment mol:protein length:184 Lactoylglutathione lyase
Sequence
MAEPQPASSGLTDETAFSCCSDPDPSTKDFLLQQTMLRIKDPKKSLDFYTRVLGLTLLQK
LDFPAMKFSLYFLAYEDKNDIPKDKSEKTAWTFSRKATLELTHNWGTEDDETQSYHNGNS
DPRGFGHIGIAVPDVYSACKRFEELGVKFVKKPDDGKMKGLAFIQDPDGYWIEILNPNKI
ATII
Download sequence
Identical sequences A5GZX3 Q9CPU0
NP_001107032.1.92730 NP_079650.3.92730 ENSMUSP00000024823 ENSMUSP00000126586 ENSMUSP00000024823 400255 cath|current|2za0A00/4-183 cath|current|2za0B00/9-184 cath|current|4kyhA00/6-182 cath|current|4kyhB00/9-184 cath|current|4kykA00/6-184 cath|current|4kykB00/8-184 2za0_A 2za0_B 4kyh_A 4kyh_B 4kyk_A 4kyk_B 4opn_A 4opn_B 4x2a_A 4x2a_B 10090.ENSMUSP00000024823 ENSMUSP00000024823

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]