SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 4v19_K from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  4v19_K
Domain Number 1 Region: 18-83
Classification Level Classification E-value
Superfamily Ribosomal L11/L12e N-terminal domain 1.46e-24
Family Ribosomal L11/L12e N-terminal domain 0.00036
Further Details:      
 
Domain Number 2 Region: 80-155
Classification Level Classification E-value
Superfamily Ribosomal protein L11, C-terminal domain 5.34e-18
Family Ribosomal protein L11, C-terminal domain 0.00066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 4v19_K
Sequence length 192
Comment mol:protein length:192 MITORIBOSOMAL PROTEIN UL11M, MRPL11
Sequence
MSKLSRATRALKKPEASGMIRAIVRAGQARPGPPLGPILGQRGVSINQFCKEFNEKTKDI
KEGIPLPTKIFVKPDRTFEIKIGQPTVSYFLKAAAGIEKGARHTGKEVAGLVTLKHVYEI
ARVKAQDDAFALQDVPLSSVVRSIIGSARSLGIRVVKDLSSEELAAFQKERALFLAAQRE
ADLAAQAEAAKK
Download sequence
Identical sequences F1RU54
4v19_K 5aj4_BK 6gaw_BK 6gb2_BK XP_003122536.1.46622 ENSSSCP00000013762 ENSSSCP00000013762 9823.ENSSSCP00000013762

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]