SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 4v19_U from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  4v19_U
Domain Number 1 Region: 15-121
Classification Level Classification E-value
Superfamily Ribosomal protein L20 2.78e-37
Family Ribosomal protein L20 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 4v19_U
Sequence length 149
Comment mol:protein length:149 MITORIBOSOMAL PROTEIN BL20M, MRPL20
Sequence
MVFLTVPLWLRSRVTDRYWRVQEVLKHARHFRGRKNRCYRLAVRAVTRAFVKCTRARRLK
KRSLRTLWINRITAASQEHGLKYPAFIINLIKCQVELNRKVLADLAIYEPKTFKSLAALA
KRRREEGFAAALGDGKEPDGIFSRVVQHR
Download sequence
Identical sequences A0A286ZU56
4v19_U 5aj4_BU 6gaw_BU 6gb2_BU XP_003127555.3.46622 ENSSSCP00000003630 ENSSSCP00000003630

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]