SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 5b6m_A from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5b6m_A
Domain Number 1 Region: 7-199
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.74e-96
Family Glutathione peroxidase-like 0.000000104
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 5b6m_A
Sequence length 224
Comment mol:protein length:224 Peroxiredoxin-6
Sequence
MPGGLLLGDVAPNFEANTTVGRIRFHDFLGDSWGILFSHPRDFTPVCTTELGRAAKLAPE
FAKRNVKLIALSIDSVEDHLAWSKDINAYNCEEPTEKLPFPIIDDRNRELAILLGMLDPA
EKDEKGMPVTARVVFVFGPDKKLKLSILYPATTGRNFDEILRVVISLQLTAEKRVATPVD
WKDGDSVMVLPTIPEEEAKKLFPKGVFTKELPSGKKYLRYTPQP
Download sequence
Identical sequences A0A2J8UBW1 G3S6S1 H2RFX7 P30041 V9HWC7
9598.ENSPTRP00000002819 9606.ENSP00000342026 gi|4758638|ref|NP_004896.1| NP_004896.1.87134 NP_004896.1.92137 XP_004027965.1.27298 XP_009454110.1.37143 XP_524972.2.37143 ENSP00000342026 ENSP00000342026 ENSP00000342026 5b6m_A 5b6m_B 5b6m_C 5b6m_D 5b6m_E 5b6m_F 5b6n_A 5b6n_B 5b6n_C 5b6n_D 5b6n_E 5b6n_F ENSPTRP00000002819 ENSPTRP00000060423 ENSPTRP00000002819 ENSPTRP00000060423

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]