SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 5d4z_U from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5d4z_U
Domain Number 1 Region: 13-68
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.00000107
Family Probable transcriptional regulator VC1968, N-terminal domain 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 5d4z_U
Sequence length 107
Comment mol:protein length:107 Repressor
Sequence
VEKQAAATLNAWMRKDTEMTSEKKVAVAAGIGPATVNRIMKAEVSTTIGVLSSLARAFGH
EAYEMIIPVGAPGIIDYDHRMYAALPQEEKNKITSFINFVFEQNKSK
Download sequence
Identical sequences 5d4z_1 5d4z_2 5d4z_3 5d4z_4 5d4z_5 5d4z_6 5d4z_7 5d4z_A 5d4z_B 5d4z_C 5d4z_D 5d4z_E 5d4z_F 5d4z_G 5d4z_H 5d4z_I 5d4z_J 5d4z_K 5d4z_L 5d4z_M 5d4z_N 5d4z_O 5d4z_P 5d4z_Q 5d4z_R 5d4z_T 5d4z_U 5d4z_V 5d4z_W 5d4z_X 5d4z_Y 5d4z_Z

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]