SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 5dqy_A from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5dqy_A
Domain Number 1 Region: 2-104
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.5e-34
Family Thioltransferase 0.0000577
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 5dqy_A
Sequence length 105
Comment mol:protein length:105 Thioredoxin
Sequence
MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVD
DCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV
Download sequence
Identical sequences A0A2J8WS16 G3QVK1 H2QXP0 H9ZYJ2 P10599
ENSP00000363639 ENSP00000363641 ENSPTRP00000036292 2ifqA ENSP00000363641 9598.ENSPTRP00000036292 9600.ENSPPYP00000021834 9606.ENSP00000363641 1auc_A 1ert_A 1eru_A 2hxk_A 2hxk_B 2hxk_C 2ifq_A 2ifq_B 2ifq_C 2iiy_A 5dqy_A NP_001125903.1.23681 NP_003320.2.87134 NP_003320.2.92137 XP_001142154.2.37143 XP_003257823.1.23891 XP_003810932.1.60992 XP_004048474.1.27298 000011259|e2ifqA1|2485.1.1.40|A:1-105 000116164|e2hxkA1|2485.1.1.40|A:1-105 000116165|e2hxkB1|2485.1.1.40|B:1-105 000116166|e1aucA1|2485.1.1.40|A:1-105 000116169|e2iiyA1|2485.1.1.40|A:1-105 000116172|e2hxkC1|2485.1.1.40|C:1-105 000116174|e2ifqB1|2485.1.1.40|B:1-105 000116183|e1eruA1|2485.1.1.40|A:1-105 000116199|e1ertA1|2485.1.1.40|A:1-105 000116200|e2ifqC1|2485.1.1.40|C:1-105 001720620|e5dqyA1|2485.1.1.40|A:1-105 cath|current|1aucA00/1-105 cath|current|1ertA00/1-105 cath|current|1eruA00/1-105 cath|current|2ifqB00/1-105 d1auca_ d1erta_ d1erua_ d2hxka_ d2hxkb_ d2hxkc_ d2ifqa_ d2ifqb_ d2ifqc_ d2iiya_ d5dqya_ ENSGGOP00000006774 gi|50592994|ref|NP_003320.2| ENSGGOP00000006774 ENSPTRP00000036292

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]