SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 5glg_A from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5glg_A
Domain Number 1 Region: 6-262,410-469
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 6.39e-48
Family Succinate dehydrogenase/fumarate reductase flavoprotein N-terminal domain 0.00055
Further Details:      
 
Domain Number 2 Region: 251-411
Classification Level Classification E-value
Superfamily Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 7.53e-24
Family Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 0.00087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 5glg_A
Sequence length 471
Comment mol:protein length:471 Fumarate reductase 2
Sequence
ASMKQPVVVIGSGLAGLTTSNRLISKYRIPVVLLDKAASIGGNSIKASSGINGAHTDTQQ
NLKVMDTPELFLKDTLHSAKGRGVPSLMDKLTKESKSAIRWLQTEFDLKLDLLAQLGGHS
VPRTHRSSGKLPPGFEIVQALSKKLKDISSKDSNLVQIMLNSEVVDIELDNQGHVTGVVY
MDENGNRKIMKSHHVVFCSGGFGYSKEMLKEYSPNLIHLPTTNGKQTTGDGQKILSKLGA
ELIDMDQVQVHPTGFIDPNDRENNWKFLAAEALRGLGGILLHPTTGRRFTNELSTRDTVT
MEIQSKCPKNDNRALLVMSDKVYENYTNNINFYMSKNLIKKVSINDLIRQYDLQTTASEL
VTELKSYSDVNTKDTFDRPLIINAFDKDISTESTVYVGEVTPVVHFTMGGVKINEKSQVI
KKNSESVLSNGIFAAGEVSGGVHGANRLGGSSLLECVVFGKTAADNIAKLY
Download sequence
Identical sequences 5glg_A 5zyn_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]