SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 5ihu_H from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5ihu_H
Domain Number 1 Region: 1-99
Classification Level Classification E-value
Superfamily Immunoglobulin 4e-36
Family V set domains (antibody variable domain-like) 0.00012
Further Details:      
 
Domain Number 2 Region: 176-271
Classification Level Classification E-value
Superfamily Immunoglobulin 1.08e-23
Family C1 set domains (antibody constant domain-like) 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 5ihu_H
Sequence length 273
Comment mol:protein length:273 bovine Fab B11 heavy chain
Sequence
QVQLRESGPSLVKPSQTLSLTCTASGFSLSDKAVGWVRQAPGKALEWLGSIDTGGTAGYN
PGLKTRLSITKDNSKSQVSLTVSSVATEDSATYYCVTVYQKTTQKKNCPDDYTECYGGAC
DGTGCCSGSCGGASACRDWWPYRSICSSDNTYTYEFHVDAWGQGLLVTVSSASTTAPKVY
PLSSCCGDKSSSTVTLGCLVSSYMPEPVTVTWNSGALKSGVHTFPAVLQSSGLYSLSSMV
TVPGSTSGQTFTCNVAHPASSTKVDKAVEPKSC
Download sequence
Identical sequences 5e99_H 5ihu_H

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]