SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 6el2_B from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  6el2_B
Domain Number 1 Region: 3-85
Classification Level Classification E-value
Superfamily Homeodomain-like 3.97e-17
Family Tetracyclin repressor-like, N-terminal domain 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 6el2_B
Sequence length 196
Comment mol:protein length:196 Transcriptional regulator TetR family
Sequence
MMYRAPKTEKGKESLNKILDASVELIADKGFLSTSINDITSKAGVAYGLFYFYFKSKHDI
LDEIIRQFNRNMRYYLKTYTQNLDSRIDVEKVGMKKFLEWMNENKKYYKIFIETQVHRPD
IYKWHFMKLAERYTTGLSEAMRRGEIINVDPELLSYVLIGIAHMLGKRYVLWSNSGLTLK
QQRDLDLIIENMLTPR
Download sequence
Identical sequences Q4J9S1
330779.Saci_1107 gi|70606882|ref|YP_255752.1| 6el2_A 6el2_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]