SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|53722161|ref|YP_111146.1| from Burkholderia pseudomallei K96243

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|53722161|ref|YP_111146.1|
Domain Number 1 Region: 4-362
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 3.38e-108
Family FMN-linked oxidoreductases 0.00000000104
Further Details:      
 
Domain Number 2 Region: 334-523
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 7.65e-41
Family N-terminal domain of adrenodoxin reductase-like 0.00000556
Further Details:      
 
Domain Number 3 Region: 463-521,557-651
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.52e-19
Family C-terminal domain of adrenodoxin reductase-like 0.0000466
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|53722161|ref|YP_111146.1|
Sequence length 673
Comment 2,4-dienoyl-CoA reductase [Burkholderia pseudomallei K96243]
Sequence
MTFYPHLTAPLELGFTSLKNRVLMGSMHVGLEEAANGFERMAAFYAERARGEAGLIVTGG
IAPNERGRMMPGGSMLTTEEEAERHRIVTRAVHDAGGRIAMQILHFGRYAYHPALVAPSA
LKAPINTFTPHALSASEVDATIDDFARCAALAQYAGYDGVEIMGSEGYLINEFIAAHTNH
REDEWGGAYENRIRFPVEIVRRVRERVGTNFIIIYRLSMLDLVEGGSTLDEVIRLAQAIE
AAGATILNTGIGWHEARIPTIATKVPRAAYAWVTKRLVGRVGIPLVATNRINTPEIAEQL
LAEGYCDMVSMARPFLADAQFVRKAREGRADEINTCIGCNQACLDHIFSGRITSCLVNPR
ACHETELVIEPAERRKRIAVVGAGPAGLSFAVTAAERGHDVELFEASPEIGGQFNIAKKV
PGKEEFHETLRYFRRQLELRGVTLHLNTRADVARLAGGGFDEIVLATGVTPRRPDIEGIG
HARVMGYLDVLRDGKPVGASVAVIGAGGIGFDVSEYLTHTGESASVAPSTFYAQWGIDID
YGARGGVRMPHVEAAPRNVHLLQRKASKVGDGLGKTTGWIHRTSLKARRVAMSSGVSYER
IDDAGLHVRIDGEPRTLAVDSVVVCAGQEPQRELYDGLRAAGCSVHLIGGAHVAAELDAK
RAILQGTTLAASI
Download sequence
Identical sequences Q63L75
WP_004552478.1.100583 WP_004552478.1.100825 WP_004552478.1.100900 WP_004552478.1.17786 WP_004552478.1.19629 WP_004552478.1.1976 WP_004552478.1.27363 WP_004552478.1.27441 WP_004552478.1.28594 WP_004552478.1.29948 WP_004552478.1.30311 WP_004552478.1.32221 WP_004552478.1.33165 WP_004552478.1.38115 WP_004552478.1.43678 WP_004552478.1.43727 WP_004552478.1.4718 WP_004552478.1.54804 WP_004552478.1.56591 WP_004552478.1.57096 WP_004552478.1.57359 WP_004552478.1.5883 WP_004552478.1.60769 WP_004552478.1.65832 WP_004552478.1.68886 WP_004552478.1.69081 WP_004552478.1.75075 WP_004552478.1.75519 WP_004552478.1.78506 WP_004552478.1.79725 WP_004552478.1.80395 WP_004552478.1.81543 WP_004552478.1.85443 WP_004552478.1.88117 WP_004552478.1.89514 WP_004552478.1.94121 WP_004552478.1.95672 YP_111146.1.59693 272560.BPSS1133 gi|53722161|ref|YP_111146.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]