SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|14590174|ref|NP_142239.1| from Pyrococcus horikoshii OT3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|14590174|ref|NP_142239.1|
Domain Number 1 Region: 250-601
Classification Level Classification E-value
Superfamily SIS domain 9.28e-105
Family double-SIS domain 0.000000147
Further Details:      
 
Domain Number 2 Region: 5-234
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 9.44e-75
Family Class II glutamine amidotransferases 0.00000218
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|14590174|ref|NP_142239.1|
Sequence length 601
Comment glucosamine--fructose-6-phosphate aminotransferase [Pyrococcus horikoshii OT3]
Sequence
MENVCGIIGYIGPRKASDVIVEGLKRLEYRGYDSAGIATCYEGKIFIKKGAGKIDELVKK
LNFLELPGNIGIGHTRWATHGIPNDTNAHPHTDCTGKIVVVHNGIIENFQELKRELLKRG
HVFRSDTDTEVIAHLIEENLRITGNFEDAFRMSLLRLRGSYALVVLFADDPERLYIARKD
SPLIIGIGKGEMFMASDIPAFLAYTRRAVFLDDGEYGIVSKDWFTIKDIITGAVKTKEIH
EIQWTLEMAEKGGYEHFMLKEIFEQPKAIKDAIYGNVKEAPKVAELLMKYDRIIITGMGT
SYHAALVGKYLIQRFGKVPVIVEEASELRYEYEDILDNRSLLIAITQSGETADTVAAMKL
AKSKGVEVVGIVNVVGSLATRIADETLYTHAGPEIGVAATKTYTTQLVVLTLLAKELGKL
VGIDVSQIEGTIPRLPELVDSSLKINDKIREIAVKLNDKRDFFYIGRGINYPTALEGALK
IKEIAYVHAEGLSAGELKHGPLALIEDGIPVVGIAPTGKTFEKMLSNIEEAKARGGFIIS
LGDDVRLHQVSDIFIRLPKVPEELAPITYIVPLQLLAYHLAVLKGHNPDRPRNLAKSVTV
E
Download sequence
Identical sequences 70601.PH0243 gi|14590174|ref|NP_142239.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]