SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|14590950|ref|NP_143024.1| from Pyrococcus horikoshii OT3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|14590950|ref|NP_143024.1|
Domain Number 1 Region: 255-395
Classification Level Classification E-value
Superfamily Ligand-binding domain in the NO signalling and Golgi transport 5.75e-22
Family MJ1460-like 0.0081
Further Details:      
 
Domain Number 2 Region: 2-231
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.99e-21
Family RecA protein-like (ATPase-domain) 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|14590950|ref|NP_143024.1|
Sequence length 397
Comment hypothetical protein PH1120 [Pyrococcus horikoshii OT3]
Sequence
MIEDNMKLKTGIPALDRILGGGFEKGCNIALVGGMDNDHILLTHQLTNAFLSSGKKVLLV
ELRQDPASLIKWLSQYNINYEEYLEDGDLKILDGFSNLYSPASISGPDVLPNPLDLGITT
AIIRDNVSKEKYDILVFDDITSLYALQTDYKAYVRVIVRLTNSIRKLGASSLVAINSDVL
SIQDLSMILMPFEYLIEIREGMIRFKRSFSFINVPGVPYVKTNKGIIPIEDVLKDAVSIR
DSLVLTSDGVLKLGEGRVQLIGETSERSLIEFVYRFLGPEKGREFLYGWGRHEVEHLEIP
KIESVEEIKEILEEAFEVTRSTGGGILRIVEATKDIIIVEGKNLFPHIRNFPYPAHVHYA
GYMAKLLEKATGERWEGEEIKCESQTNDKCIFILRRV
Download sequence
Identical sequences O58847
gi|14590950|ref|NP_143024.1| 70601.PH1120 382449

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]