SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|378701844|ref|YP_005183802.1| from Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|378701844|ref|YP_005183802.1|
Domain Number 1 Region: 6-325
Classification Level Classification E-value
Superfamily FMN-binding split barrel 1.41e-128
Family UbiD middle domain-like 0.00000000000987
Further Details:      
 
Domain Number 2 Region: 326-489
Classification Level Classification E-value
Superfamily UbiD C-terminal domain-like 1.83e-66
Family UbiD C-terminal domain-like 0.0000000196
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|378701844|ref|YP_005183802.1|
Sequence length 492
Comment hypothetical protein SL1344_3932 [Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344]
Sequence
MDAMKYHDLRDFLTLLEQQGELKRITLPVDPHLEITEIADRTLRAGGPALLFENPKGYAM
PVLCNLFGTPKRVAMGMGQDDVSALREVGKLLAFLKEPEPPKGFRDLFDKLPQFKQVLNM
PTKRLRGAPCQQKIASGDDVDLTRLPVMTCWPDDAAPLITWGLTVTRGPHKERQNLGIYR
QQLIGKNKLIMRWLSHRGGALDFQEWLAARPGERFPVSVALGADPATILGAVTPVPDTLS
EYAFAGLLRGTKTEVVKCLSNDLEVPASAEIILEGYIEPGEMAPEGPYGDHTGYYNEVDS
FPVFTVTHITQREDAIYHSTYTGRPPDEPAVLGVALNEVFVPILQKQFPEIVDFYLPPEG
CSYRLAVVTMKKQYAGHAKRVMMGVWSFLRQFMYTKFVIVCDDDVNARDWNDVIWAITTR
MDPARDTVLVENTPIDYLDFASPVSGLGSKMGLDATNKWPGETQREWGRPIVKDPEVTAR
IDAIWDELAIFK
Download sequence
Identical sequences A0A0F6B9E6 A0A0F7JC86 A0A0H3NHY5 A0A0T7RY66 A0A0U1JAP6 A0A221YSC8 A0A221Z6J5 A0A232R0J1 A0A265AZ49 A0A2C6Z9D4 A0A2H9YD37 E8XJG7 Q9L6M0
454169.SeHA_C4305 99287.STM3978 gi|194448365|ref|YP_002047988.1| gi|379703227|ref|YP_005244955.1| gi|378991266|ref|YP_005254430.1| ABAK02000001|CDS_3491599-3493077 ABAN01000033|CDS_13383-11905 ABAO01000030|CDS_42285-43763 ABEH02000008|CDS_86460-87938 ABEI01000022|CDS_42411-43889 ABEL01000016|CDS_40624-42102 ABEW01000013|CDS_12102-10624 ABFF01000023|CDS_11887-10409 ABFH02000001|CDS_948920-947442 AE006468|CDS_4183598-4185076 CP001120|CDS_4191974-4193452 CP001363|CDS_4197289-4198767 FN424405|CDS_4206472-4207950 NP_462863.1.58477 WP_000339764.1.100002 WP_000339764.1.100010 WP_000339764.1.100115 WP_000339764.1.100234 WP_000339764.1.100266 WP_000339764.1.100376 WP_000339764.1.100424 WP_000339764.1.100436 WP_000339764.1.100472 WP_000339764.1.100484 WP_000339764.1.100488 WP_000339764.1.100521 WP_000339764.1.100589 WP_000339764.1.100597 WP_000339764.1.100707 WP_000339764.1.100730 WP_000339764.1.10074 WP_000339764.1.10076 WP_000339764.1.100781 WP_000339764.1.100793 WP_000339764.1.100869 WP_000339764.1.100870 WP_000339764.1.100871 WP_000339764.1.100882 WP_000339764.1.100944 WP_000339764.1.101007 WP_000339764.1.101020 WP_000339764.1.101074 WP_000339764.1.101078 WP_000339764.1.101091 WP_000339764.1.101123 WP_000339764.1.101126 WP_000339764.1.101180 WP_000339764.1.101185 WP_000339764.1.101259 WP_000339764.1.101284 WP_000339764.1.101291 WP_000339764.1.1013 WP_000339764.1.101353 WP_000339764.1.101386 WP_000339764.1.101404 WP_000339764.1.101420 WP_000339764.1.101454 WP_000339764.1.101519 WP_000339764.1.101520 WP_000339764.1.101589 WP_000339764.1.101636 WP_000339764.1.101707 WP_000339764.1.101734 WP_000339764.1.101839 WP_000339764.1.101878 WP_000339764.1.101949 WP_000339764.1.101953 WP_000339764.1.101975 WP_000339764.1.102103 WP_000339764.1.10220 WP_000339764.1.10231 WP_000339764.1.10237 WP_000339764.1.10266 WP_000339764.1.10310 WP_000339764.1.10429 WP_000339764.1.10439 WP_000339764.1.10566 WP_000339764.1.10678 WP_000339764.1.10711 WP_000339764.1.10753 WP_000339764.1.10992 WP_000339764.1.11024 WP_000339764.1.11031 WP_000339764.1.11098 WP_000339764.1.1110 WP_000339764.1.11156 WP_000339764.1.11190 WP_000339764.1.11295 WP_000339764.1.11362 WP_000339764.1.11455 WP_000339764.1.11458 WP_000339764.1.11518 WP_000339764.1.11532 WP_000339764.1.11543 WP_000339764.1.11588 WP_000339764.1.11677 WP_000339764.1.11687 WP_000339764.1.11735 WP_000339764.1.11763 WP_000339764.1.11772 WP_000339764.1.11834 WP_000339764.1.11897 WP_000339764.1.11964 WP_000339764.1.12017 WP_000339764.1.12114 WP_000339764.1.12159 WP_000339764.1.12244 WP_000339764.1.12280 WP_000339764.1.12351 WP_000339764.1.12370 WP_000339764.1.12472 WP_000339764.1.12546 WP_000339764.1.12584 WP_000339764.1.1264 WP_000339764.1.12701 WP_000339764.1.12718 WP_000339764.1.12728 WP_000339764.1.12879 WP_000339764.1.12936 WP_000339764.1.12995 WP_000339764.1.13027 WP_000339764.1.13106 WP_000339764.1.13130 WP_000339764.1.13207 WP_000339764.1.13414 WP_000339764.1.13488 WP_000339764.1.13509 WP_000339764.1.13661 WP_000339764.1.13669 WP_000339764.1.13677 WP_000339764.1.13741 WP_000339764.1.13764 WP_000339764.1.13857 WP_000339764.1.1387 WP_000339764.1.13908 WP_000339764.1.13932 WP_000339764.1.13968 WP_000339764.1.14001 WP_000339764.1.14050 WP_000339764.1.14056 WP_000339764.1.14111 WP_000339764.1.14151 WP_000339764.1.14286 WP_000339764.1.14320 WP_000339764.1.14369 WP_000339764.1.14379 WP_000339764.1.14406 WP_000339764.1.14410 WP_000339764.1.14436 WP_000339764.1.14458 WP_000339764.1.14466 WP_000339764.1.14495 WP_000339764.1.14505 WP_000339764.1.14516 WP_000339764.1.14519 WP_000339764.1.14524 WP_000339764.1.14554 WP_000339764.1.14618 WP_000339764.1.14688 WP_000339764.1.14725 WP_000339764.1.14852 WP_000339764.1.14876 WP_000339764.1.1489 WP_000339764.1.14932 WP_000339764.1.14964 WP_000339764.1.15055 WP_000339764.1.15124 WP_000339764.1.15223 WP_000339764.1.15226 WP_000339764.1.15316 WP_000339764.1.15369 WP_000339764.1.1540 WP_000339764.1.15508 WP_000339764.1.15627 WP_000339764.1.15784 WP_000339764.1.158 WP_000339764.1.15830 WP_000339764.1.15862 WP_000339764.1.15910 WP_000339764.1.15986 WP_000339764.1.16000 WP_000339764.1.16004 WP_000339764.1.16006 WP_000339764.1.16032 WP_000339764.1.16047 WP_000339764.1.16063 WP_000339764.1.16103 WP_000339764.1.16226 WP_000339764.1.16233 WP_000339764.1.16284 WP_000339764.1.16328 WP_000339764.1.1635 WP_000339764.1.16361 WP_000339764.1.16468 WP_000339764.1.16525 WP_000339764.1.16551 WP_000339764.1.16614 WP_000339764.1.16650 WP_000339764.1.16686 WP_000339764.1.16691 WP_000339764.1.16732 WP_000339764.1.16735 WP_000339764.1.16736 WP_000339764.1.16786 WP_000339764.1.16817 WP_000339764.1.16819 WP_000339764.1.16846 WP_000339764.1.16858 WP_000339764.1.16873 WP_000339764.1.16896 WP_000339764.1.16903 WP_000339764.1.16916 WP_000339764.1.16965 WP_000339764.1.1700 WP_000339764.1.17093 WP_000339764.1.17098 WP_000339764.1.17307 WP_000339764.1.1737 WP_000339764.1.17390 WP_000339764.1.174 WP_000339764.1.17480 WP_000339764.1.1749 WP_000339764.1.17504 WP_000339764.1.17546 WP_000339764.1.1757 WP_000339764.1.17702 WP_000339764.1.17705 WP_000339764.1.17743 WP_000339764.1.17891 WP_000339764.1.17919 WP_000339764.1.1798 WP_000339764.1.18019 WP_000339764.1.18089 WP_000339764.1.18103 WP_000339764.1.18111 WP_000339764.1.18122 WP_000339764.1.18163 WP_000339764.1.1818 WP_000339764.1.1825 WP_000339764.1.18254 WP_000339764.1.18265 WP_000339764.1.18267 WP_000339764.1.18468 WP_000339764.1.18607 WP_000339764.1.18705 WP_000339764.1.18715 WP_000339764.1.18776 WP_000339764.1.18822 WP_000339764.1.18881 WP_000339764.1.18940 WP_000339764.1.18949 WP_000339764.1.19053 WP_000339764.1.19273 WP_000339764.1.19291 WP_000339764.1.19320 WP_000339764.1.19458 WP_000339764.1.19460 WP_000339764.1.19461 WP_000339764.1.19588 WP_000339764.1.19614 WP_000339764.1.19616 WP_000339764.1.19660 WP_000339764.1.1968 WP_000339764.1.19702 WP_000339764.1.19706 WP_000339764.1.19724 WP_000339764.1.19740 WP_000339764.1.19784 WP_000339764.1.19802 WP_000339764.1.19809 WP_000339764.1.19867 WP_000339764.1.19975 WP_000339764.1.1998 WP_000339764.1.20 WP_000339764.1.20034 WP_000339764.1.2010 WP_000339764.1.20119 WP_000339764.1.20212 WP_000339764.1.20266 WP_000339764.1.20271 WP_000339764.1.20349 WP_000339764.1.20362 WP_000339764.1.20364 WP_000339764.1.20376 WP_000339764.1.20415 WP_000339764.1.20418 WP_000339764.1.20443 WP_000339764.1.20446 WP_000339764.1.20488 WP_000339764.1.20525 WP_000339764.1.2054 WP_000339764.1.20553 WP_000339764.1.20614 WP_000339764.1.20626 WP_000339764.1.20646 WP_000339764.1.20700 WP_000339764.1.20721 WP_000339764.1.20862 WP_000339764.1.20886 WP_000339764.1.20900 WP_000339764.1.20908 WP_000339764.1.21049 WP_000339764.1.21136 WP_000339764.1.21146 WP_000339764.1.21245 WP_000339764.1.21246 WP_000339764.1.21269 WP_000339764.1.21286 WP_000339764.1.2130 WP_000339764.1.21351 WP_000339764.1.21399 WP_000339764.1.21400 WP_000339764.1.21443 WP_000339764.1.21453 WP_000339764.1.2146 WP_000339764.1.21497 WP_000339764.1.21499 WP_000339764.1.21603 WP_000339764.1.21751 WP_000339764.1.21757 WP_000339764.1.21910 WP_000339764.1.21991 WP_000339764.1.22024 WP_000339764.1.2205 WP_000339764.1.22062 WP_000339764.1.22067 WP_000339764.1.22205 WP_000339764.1.2221 WP_000339764.1.22235 WP_000339764.1.2224 WP_000339764.1.22337 WP_000339764.1.2235 WP_000339764.1.22379 WP_000339764.1.22388 WP_000339764.1.22427 WP_000339764.1.2246 WP_000339764.1.22485 WP_000339764.1.22565 WP_000339764.1.22575 WP_000339764.1.22620 WP_000339764.1.22692 WP_000339764.1.22758 WP_000339764.1.22864 WP_000339764.1.22870 WP_000339764.1.22979 WP_000339764.1.23102 WP_000339764.1.23114 WP_000339764.1.2314 WP_000339764.1.23148 WP_000339764.1.23169 WP_000339764.1.23175 WP_000339764.1.23192 WP_000339764.1.23201 WP_000339764.1.23259 WP_000339764.1.23311 WP_000339764.1.23343 WP_000339764.1.23379 WP_000339764.1.23460 WP_000339764.1.23466 WP_000339764.1.23472 WP_000339764.1.23482 WP_000339764.1.23500 WP_000339764.1.23509 WP_000339764.1.23621 WP_000339764.1.23634 WP_000339764.1.2364 WP_000339764.1.23643 WP_000339764.1.23646 WP_000339764.1.23685 WP_000339764.1.237 WP_000339764.1.23707 WP_000339764.1.23720 WP_000339764.1.2380 WP_000339764.1.23819 WP_000339764.1.23932 WP_000339764.1.23959 WP_000339764.1.24017 WP_000339764.1.24082 WP_000339764.1.24206 WP_000339764.1.24259 WP_000339764.1.24308 WP_000339764.1.24325 WP_000339764.1.24578 WP_000339764.1.24686 WP_000339764.1.24737 WP_000339764.1.24779 WP_000339764.1.24839 WP_000339764.1.24995 WP_000339764.1.25008 WP_000339764.1.25015 WP_000339764.1.25036 WP_000339764.1.25064 WP_000339764.1.25119 WP_000339764.1.25405 WP_000339764.1.25454 WP_000339764.1.25493 WP_000339764.1.25668 WP_000339764.1.25690 WP_000339764.1.2570 WP_000339764.1.25700 WP_000339764.1.25740 WP_000339764.1.25793 WP_000339764.1.25814 WP_000339764.1.25928 WP_000339764.1.25932 WP_000339764.1.25988 WP_000339764.1.26030 WP_000339764.1.26282 WP_000339764.1.26311 WP_000339764.1.26319 WP_000339764.1.2634 WP_000339764.1.26429 WP_000339764.1.26440 WP_000339764.1.26493 WP_000339764.1.26551 WP_000339764.1.26563 WP_000339764.1.26567 WP_000339764.1.2660 WP_000339764.1.26741 WP_000339764.1.26758 WP_000339764.1.26856 WP_000339764.1.26882 WP_000339764.1.26892 WP_000339764.1.26919 WP_000339764.1.27010 WP_000339764.1.27072 WP_000339764.1.27084 WP_000339764.1.27122 WP_000339764.1.27173 WP_000339764.1.27206 WP_000339764.1.27279 WP_000339764.1.27423 WP_000339764.1.27522 WP_000339764.1.27535 WP_000339764.1.27544 WP_000339764.1.27556 WP_000339764.1.27561 WP_000339764.1.2763 WP_000339764.1.27665 WP_000339764.1.27707 WP_000339764.1.27761 WP_000339764.1.2777 WP_000339764.1.27857 WP_000339764.1.27977 WP_000339764.1.27997 WP_000339764.1.28032 WP_000339764.1.28073 WP_000339764.1.28094 WP_000339764.1.28170 WP_000339764.1.28302 WP_000339764.1.2835 WP_000339764.1.28370 WP_000339764.1.28538 WP_000339764.1.28575 WP_000339764.1.28625 WP_000339764.1.28655 WP_000339764.1.28673 WP_000339764.1.28694 WP_000339764.1.287 WP_000339764.1.2879 WP_000339764.1.2890 WP_000339764.1.28946 WP_000339764.1.28948 WP_000339764.1.29006 WP_000339764.1.29010 WP_000339764.1.2910 WP_000339764.1.29113 WP_000339764.1.29349 WP_000339764.1.29509 WP_000339764.1.29588 WP_000339764.1.29601 WP_000339764.1.29606 WP_000339764.1.29615 WP_000339764.1.29619 WP_000339764.1.29704 WP_000339764.1.29827 WP_000339764.1.29898 WP_000339764.1.29969 WP_000339764.1.29990 WP_000339764.1.30006 WP_000339764.1.30022 WP_000339764.1.30027 WP_000339764.1.30093 WP_000339764.1.3017 WP_000339764.1.30170 WP_000339764.1.30180 WP_000339764.1.30202 WP_000339764.1.30356 WP_000339764.1.30425 WP_000339764.1.30469 WP_000339764.1.30505 WP_000339764.1.30507 WP_000339764.1.30535 WP_000339764.1.30547 WP_000339764.1.30573 WP_000339764.1.30602 WP_000339764.1.30635 WP_000339764.1.3068 WP_000339764.1.30794 WP_000339764.1.30803 WP_000339764.1.30823 WP_000339764.1.30833 WP_000339764.1.30835 WP_000339764.1.30972 WP_000339764.1.31 WP_000339764.1.31011 WP_000339764.1.31092 WP_000339764.1.31107 WP_000339764.1.31122 WP_000339764.1.3113 WP_000339764.1.3114 WP_000339764.1.31185 WP_000339764.1.3119 WP_000339764.1.31190 WP_000339764.1.31195 WP_000339764.1.31196 WP_000339764.1.31198 WP_000339764.1.3124 WP_000339764.1.31251 WP_000339764.1.31281 WP_000339764.1.31362 WP_000339764.1.31451 WP_000339764.1.31504 WP_000339764.1.31515 WP_000339764.1.31578 WP_000339764.1.31658 WP_000339764.1.31665 WP_000339764.1.31762 WP_000339764.1.31940 WP_000339764.1.31967 WP_000339764.1.31972 WP_000339764.1.32056 WP_000339764.1.32170 WP_000339764.1.32192 WP_000339764.1.32206 WP_000339764.1.32260 WP_000339764.1.32368 WP_000339764.1.32434 WP_000339764.1.32438 WP_000339764.1.32491 WP_000339764.1.32515 WP_000339764.1.32545 WP_000339764.1.32660 WP_000339764.1.32702 WP_000339764.1.32714 WP_000339764.1.32747 WP_000339764.1.32786 WP_000339764.1.32804 WP_000339764.1.32907 WP_000339764.1.32930 WP_000339764.1.32961 WP_000339764.1.33030 WP_000339764.1.33078 WP_000339764.1.3310 WP_000339764.1.33106 WP_000339764.1.33127 WP_000339764.1.33143 WP_000339764.1.33248 WP_000339764.1.33261 WP_000339764.1.333 WP_000339764.1.33492 WP_000339764.1.33499 WP_000339764.1.33553 WP_000339764.1.33580 WP_000339764.1.33592 WP_000339764.1.33609 WP_000339764.1.33693 WP_000339764.1.33894 WP_000339764.1.3394 WP_000339764.1.3395 WP_000339764.1.33986 WP_000339764.1.34043 WP_000339764.1.34075 WP_000339764.1.34107 WP_000339764.1.34184 WP_000339764.1.34257 WP_000339764.1.34259 WP_000339764.1.34279 WP_000339764.1.34319 WP_000339764.1.34417 WP_000339764.1.34453 WP_000339764.1.34458 WP_000339764.1.34496 WP_000339764.1.34610 WP_000339764.1.34667 WP_000339764.1.34703 WP_000339764.1.34707 WP_000339764.1.34801 WP_000339764.1.34854 WP_000339764.1.34856 WP_000339764.1.3489 WP_000339764.1.34972 WP_000339764.1.34975 WP_000339764.1.35045 WP_000339764.1.35129 WP_000339764.1.35184 WP_000339764.1.35193 WP_000339764.1.35404 WP_000339764.1.35408 WP_000339764.1.35425 WP_000339764.1.35446 WP_000339764.1.35460 WP_000339764.1.35463 WP_000339764.1.35503 WP_000339764.1.35509 WP_000339764.1.35590 WP_000339764.1.35777 WP_000339764.1.35892 WP_000339764.1.35940 WP_000339764.1.36003 WP_000339764.1.3601 WP_000339764.1.36017 WP_000339764.1.36542 WP_000339764.1.36547 WP_000339764.1.36609 WP_000339764.1.36652 WP_000339764.1.36690 WP_000339764.1.3670 WP_000339764.1.36705 WP_000339764.1.36839 WP_000339764.1.36899 WP_000339764.1.36918 WP_000339764.1.36931 WP_000339764.1.37073 WP_000339764.1.37111 WP_000339764.1.37112 WP_000339764.1.37256 WP_000339764.1.37293 WP_000339764.1.37320 WP_000339764.1.37370 WP_000339764.1.37376 WP_000339764.1.3744 WP_000339764.1.37478 WP_000339764.1.37498 WP_000339764.1.37504 WP_000339764.1.3751 WP_000339764.1.37521 WP_000339764.1.37618 WP_000339764.1.37666 WP_000339764.1.37968 WP_000339764.1.37978 WP_000339764.1.38001 WP_000339764.1.38125 WP_000339764.1.38145 WP_000339764.1.38273 WP_000339764.1.383 WP_000339764.1.38322 WP_000339764.1.38349 WP_000339764.1.38393 WP_000339764.1.38408 WP_000339764.1.3848 WP_000339764.1.38512 WP_000339764.1.38569 WP_000339764.1.38613 WP_000339764.1.38622 WP_000339764.1.38673 WP_000339764.1.38693 WP_000339764.1.38740 WP_000339764.1.38773 WP_000339764.1.38781 WP_000339764.1.38830 WP_000339764.1.38882 WP_000339764.1.3891 WP_000339764.1.38913 WP_000339764.1.39003 WP_000339764.1.39038 WP_000339764.1.39128 WP_000339764.1.39136 WP_000339764.1.39183 WP_000339764.1.39197 WP_000339764.1.39229 WP_000339764.1.39265 WP_000339764.1.39275 WP_000339764.1.39385 WP_000339764.1.39405 WP_000339764.1.39420 WP_000339764.1.39449 WP_000339764.1.39512 WP_000339764.1.39553 WP_000339764.1.39576 WP_000339764.1.39584 WP_000339764.1.39609 WP_000339764.1.39629 WP_000339764.1.39724 WP_000339764.1.39763 WP_000339764.1.39808 WP_000339764.1.39862 WP_000339764.1.39921 WP_000339764.1.39923 WP_000339764.1.40008 WP_000339764.1.40017 WP_000339764.1.40025 WP_000339764.1.40072 WP_000339764.1.40073 WP_000339764.1.4011 WP_000339764.1.40111 WP_000339764.1.40170 WP_000339764.1.40208 WP_000339764.1.40229 WP_000339764.1.40240 WP_000339764.1.40257 WP_000339764.1.40258 WP_000339764.1.40292 WP_000339764.1.40305 WP_000339764.1.40311 WP_000339764.1.40341 WP_000339764.1.40380 WP_000339764.1.40395 WP_000339764.1.40465 WP_000339764.1.40648 WP_000339764.1.40710 WP_000339764.1.40722 WP_000339764.1.4075 WP_000339764.1.40771 WP_000339764.1.40788 WP_000339764.1.4087 WP_000339764.1.40877 WP_000339764.1.40996 WP_000339764.1.41017 WP_000339764.1.41018 WP_000339764.1.41086 WP_000339764.1.41091 WP_000339764.1.41226 WP_000339764.1.41279 WP_000339764.1.41310 WP_000339764.1.41440 WP_000339764.1.41516 WP_000339764.1.41554 WP_000339764.1.41572 WP_000339764.1.41591 WP_000339764.1.41662 WP_000339764.1.41708 WP_000339764.1.41761 WP_000339764.1.4178 WP_000339764.1.41877 WP_000339764.1.41882 WP_000339764.1.41904 WP_000339764.1.41979 WP_000339764.1.41985 WP_000339764.1.42104 WP_000339764.1.42109 WP_000339764.1.42156 WP_000339764.1.4222 WP_000339764.1.42238 WP_000339764.1.42243 WP_000339764.1.42244 WP_000339764.1.42248 WP_000339764.1.42320 WP_000339764.1.42342 WP_000339764.1.42422 WP_000339764.1.42433 WP_000339764.1.42444 WP_000339764.1.42489 WP_000339764.1.42605 WP_000339764.1.42655 WP_000339764.1.42676 WP_000339764.1.42685 WP_000339764.1.4276 WP_000339764.1.42794 WP_000339764.1.42864 WP_000339764.1.4288 WP_000339764.1.42923 WP_000339764.1.42957 WP_000339764.1.42978 WP_000339764.1.43018 WP_000339764.1.43041 WP_000339764.1.43077 WP_000339764.1.43160 WP_000339764.1.43244 WP_000339764.1.43276 WP_000339764.1.43312 WP_000339764.1.43334 WP_000339764.1.43339 WP_000339764.1.43371 WP_000339764.1.43437 WP_000339764.1.43441 WP_000339764.1.43476 WP_000339764.1.43520 WP_000339764.1.43522 WP_000339764.1.43606 WP_000339764.1.43613 WP_000339764.1.43668 WP_000339764.1.43778 WP_000339764.1.43839 WP_000339764.1.43886 WP_000339764.1.43951 WP_000339764.1.44005 WP_000339764.1.44043 WP_000339764.1.44099 WP_000339764.1.44113 WP_000339764.1.44121 WP_000339764.1.44250 WP_000339764.1.44291 WP_000339764.1.44300 WP_000339764.1.44310 WP_000339764.1.44386 WP_000339764.1.4440 WP_000339764.1.44433 WP_000339764.1.44443 WP_000339764.1.44479 WP_000339764.1.44593 WP_000339764.1.44607 WP_000339764.1.44633 WP_000339764.1.44640 WP_000339764.1.4467 WP_000339764.1.44678 WP_000339764.1.44702 WP_000339764.1.44747 WP_000339764.1.44833 WP_000339764.1.4485 WP_000339764.1.44877 WP_000339764.1.449 WP_000339764.1.44927 WP_000339764.1.44933 WP_000339764.1.44950 WP_000339764.1.44998 WP_000339764.1.45027 WP_000339764.1.45045 WP_000339764.1.45067 WP_000339764.1.45074 WP_000339764.1.45079 WP_000339764.1.45098 WP_000339764.1.45145 WP_000339764.1.45177 WP_000339764.1.45184 WP_000339764.1.45229 WP_000339764.1.45259 WP_000339764.1.45349 WP_000339764.1.45365 WP_000339764.1.4540 WP_000339764.1.45434 WP_000339764.1.45550 WP_000339764.1.45582 WP_000339764.1.45585 WP_000339764.1.45622 WP_000339764.1.45660 WP_000339764.1.45690 WP_000339764.1.45781 WP_000339764.1.458 WP_000339764.1.45848 WP_000339764.1.46011 WP_000339764.1.46028 WP_000339764.1.46069 WP_000339764.1.46091 WP_000339764.1.46112 WP_000339764.1.46173 WP_000339764.1.46174 WP_000339764.1.46187 WP_000339764.1.46205 WP_000339764.1.46232 WP_000339764.1.46278 WP_000339764.1.46286 WP_000339764.1.46303 WP_000339764.1.46323 WP_000339764.1.46406 WP_000339764.1.46434 WP_000339764.1.46444 WP_000339764.1.46572 WP_000339764.1.46574 WP_000339764.1.46595 WP_000339764.1.46666 WP_000339764.1.46675 WP_000339764.1.46693 WP_000339764.1.4671 WP_000339764.1.46749 WP_000339764.1.47008 WP_000339764.1.47057 WP_000339764.1.47058 WP_000339764.1.47067 WP_000339764.1.47214 WP_000339764.1.47257 WP_000339764.1.47429 WP_000339764.1.47448 WP_000339764.1.4747 WP_000339764.1.47472 WP_000339764.1.47478 WP_000339764.1.47506 WP_000339764.1.47579 WP_000339764.1.47621 WP_000339764.1.47649 WP_000339764.1.4770 WP_000339764.1.47714 WP_000339764.1.47799 WP_000339764.1.47814 WP_000339764.1.48209 WP_000339764.1.48242 WP_000339764.1.48253 WP_000339764.1.48367 WP_000339764.1.48377 WP_000339764.1.48455 WP_000339764.1.4853 WP_000339764.1.48570 WP_000339764.1.48651 WP_000339764.1.48788 WP_000339764.1.4885 WP_000339764.1.48855 WP_000339764.1.48876 WP_000339764.1.48886 WP_000339764.1.48894 WP_000339764.1.48918 WP_000339764.1.48919 WP_000339764.1.48931 WP_000339764.1.48985 WP_000339764.1.49005 WP_000339764.1.49012 WP_000339764.1.49084 WP_000339764.1.49113 WP_000339764.1.49155 WP_000339764.1.49204 WP_000339764.1.49239 WP_000339764.1.49256 WP_000339764.1.49290 WP_000339764.1.49304 WP_000339764.1.49340 WP_000339764.1.49358 WP_000339764.1.49366 WP_000339764.1.49443 WP_000339764.1.49472 WP_000339764.1.49490 WP_000339764.1.49515 WP_000339764.1.49572 WP_000339764.1.49626 WP_000339764.1.49686 WP_000339764.1.49780 WP_000339764.1.4979 WP_000339764.1.49803 WP_000339764.1.49805 WP_000339764.1.49929 WP_000339764.1.50 WP_000339764.1.50003 WP_000339764.1.50080 WP_000339764.1.50161 WP_000339764.1.50211 WP_000339764.1.50238 WP_000339764.1.50239 WP_000339764.1.50251 WP_000339764.1.50374 WP_000339764.1.50376 WP_000339764.1.50389 WP_000339764.1.50404 WP_000339764.1.50469 WP_000339764.1.50563 WP_000339764.1.50576 WP_000339764.1.5058 WP_000339764.1.50676 WP_000339764.1.50782 WP_000339764.1.50800 WP_000339764.1.50804 WP_000339764.1.50808 WP_000339764.1.5088 WP_000339764.1.50893 WP_000339764.1.50908 WP_000339764.1.50941 WP_000339764.1.50999 WP_000339764.1.51014 WP_000339764.1.51022 WP_000339764.1.51025 WP_000339764.1.51066 WP_000339764.1.51179 WP_000339764.1.51182 WP_000339764.1.51186 WP_000339764.1.51224 WP_000339764.1.51285 WP_000339764.1.51308 WP_000339764.1.51414 WP_000339764.1.51487 WP_000339764.1.51488 WP_000339764.1.51514 WP_000339764.1.51634 WP_000339764.1.51649 WP_000339764.1.51686 WP_000339764.1.51700 WP_000339764.1.51756 WP_000339764.1.51831 WP_000339764.1.51911 WP_000339764.1.51932 WP_000339764.1.51989 WP_000339764.1.52121 WP_000339764.1.52123 WP_000339764.1.5216 WP_000339764.1.52170 WP_000339764.1.52336 WP_000339764.1.52346 WP_000339764.1.52353 WP_000339764.1.52361 WP_000339764.1.52438 WP_000339764.1.52528 WP_000339764.1.52653 WP_000339764.1.52656 WP_000339764.1.52692 WP_000339764.1.52743 WP_000339764.1.52744 WP_000339764.1.52857 WP_000339764.1.52866 WP_000339764.1.52898 WP_000339764.1.52915 WP_000339764.1.52949 WP_000339764.1.52985 WP_000339764.1.53190 WP_000339764.1.53203 WP_000339764.1.53272 WP_000339764.1.53286 WP_000339764.1.53406 WP_000339764.1.53454 WP_000339764.1.53466 WP_000339764.1.53529 WP_000339764.1.53534 WP_000339764.1.53543 WP_000339764.1.53675 WP_000339764.1.53757 WP_000339764.1.53812 WP_000339764.1.53905 WP_000339764.1.53935 WP_000339764.1.54033 WP_000339764.1.54075 WP_000339764.1.54136 WP_000339764.1.54196 WP_000339764.1.54209 WP_000339764.1.54271 WP_000339764.1.54274 WP_000339764.1.54319 WP_000339764.1.54364 WP_000339764.1.54400 WP_000339764.1.54522 WP_000339764.1.54526 WP_000339764.1.5456 WP_000339764.1.54569 WP_000339764.1.5459 WP_000339764.1.54644 WP_000339764.1.54662 WP_000339764.1.54722 WP_000339764.1.54749 WP_000339764.1.54764 WP_000339764.1.54814 WP_000339764.1.54845 WP_000339764.1.5493 WP_000339764.1.54992 WP_000339764.1.55008 WP_000339764.1.55073 WP_000339764.1.55152 WP_000339764.1.55156 WP_000339764.1.5523 WP_000339764.1.55285 WP_000339764.1.55325 WP_000339764.1.55361 WP_000339764.1.55430 WP_000339764.1.55475 WP_000339764.1.55545 WP_000339764.1.5555 WP_000339764.1.55557 WP_000339764.1.5560 WP_000339764.1.55623 WP_000339764.1.55647 WP_000339764.1.55672 WP_000339764.1.55743 WP_000339764.1.55768 WP_000339764.1.55782 WP_000339764.1.55796 WP_000339764.1.55973 WP_000339764.1.56002 WP_000339764.1.56012 WP_000339764.1.56026 WP_000339764.1.56059 WP_000339764.1.56097 WP_000339764.1.56105 WP_000339764.1.56152 WP_000339764.1.56222 WP_000339764.1.56238 WP_000339764.1.56244 WP_000339764.1.56286 WP_000339764.1.56303 WP_000339764.1.56304 WP_000339764.1.56305 WP_000339764.1.56370 WP_000339764.1.56414 WP_000339764.1.56438 WP_000339764.1.56512 WP_000339764.1.56559 WP_000339764.1.56560 WP_000339764.1.56601 WP_000339764.1.56614 WP_000339764.1.56647 WP_000339764.1.56660 WP_000339764.1.56671 WP_000339764.1.56682 WP_000339764.1.56853 WP_000339764.1.56875 WP_000339764.1.56877 WP_000339764.1.56893 WP_000339764.1.56905 WP_000339764.1.57000 WP_000339764.1.57168 WP_000339764.1.57187 WP_000339764.1.57233 WP_000339764.1.57356 WP_000339764.1.57377 WP_000339764.1.57418 WP_000339764.1.57433 WP_000339764.1.57494 WP_000339764.1.57515 WP_000339764.1.57529 WP_000339764.1.57576 WP_000339764.1.57601 WP_000339764.1.57607 WP_000339764.1.57709 WP_000339764.1.5774 WP_000339764.1.57763 WP_000339764.1.57862 WP_000339764.1.57890 WP_000339764.1.57891 WP_000339764.1.57978 WP_000339764.1.5801 WP_000339764.1.58040 WP_000339764.1.58041 WP_000339764.1.58153 WP_000339764.1.58358 WP_000339764.1.58407 WP_000339764.1.58418 WP_000339764.1.58442 WP_000339764.1.5846 WP_000339764.1.58548 WP_000339764.1.58564 WP_000339764.1.5858 WP_000339764.1.58662 WP_000339764.1.58669 WP_000339764.1.58745 WP_000339764.1.5878 WP_000339764.1.58803 WP_000339764.1.58836 WP_000339764.1.5886 WP_000339764.1.59084 WP_000339764.1.59094 WP_000339764.1.59224 WP_000339764.1.59294 WP_000339764.1.59321 WP_000339764.1.59336 WP_000339764.1.59375 WP_000339764.1.59381 WP_000339764.1.59412 WP_000339764.1.59420 WP_000339764.1.59458 WP_000339764.1.59490 WP_000339764.1.59508 WP_000339764.1.59641 WP_000339764.1.59684 WP_000339764.1.59694 WP_000339764.1.59771 WP_000339764.1.5979 WP_000339764.1.59830 WP_000339764.1.59953 WP_000339764.1.60008 WP_000339764.1.60015 WP_000339764.1.60021 WP_000339764.1.60069 WP_000339764.1.60140 WP_000339764.1.60155 WP_000339764.1.60209 WP_000339764.1.60226 WP_000339764.1.60285 WP_000339764.1.60379 WP_000339764.1.60464 WP_000339764.1.60545 WP_000339764.1.60561 WP_000339764.1.60643 WP_000339764.1.60772 WP_000339764.1.60794 WP_000339764.1.6086 WP_000339764.1.60874 WP_000339764.1.60919 WP_000339764.1.60941 WP_000339764.1.60976 WP_000339764.1.61078 WP_000339764.1.6114 WP_000339764.1.61201 WP_000339764.1.61232 WP_000339764.1.6129 WP_000339764.1.61296 WP_000339764.1.61345 WP_000339764.1.61417 WP_000339764.1.61574 WP_000339764.1.61582 WP_000339764.1.6164 WP_000339764.1.61712 WP_000339764.1.61714 WP_000339764.1.61730 WP_000339764.1.61743 WP_000339764.1.61857 WP_000339764.1.61918 WP_000339764.1.61924 WP_000339764.1.61952 WP_000339764.1.61968 WP_000339764.1.62007 WP_000339764.1.62020 WP_000339764.1.62025 WP_000339764.1.6209 WP_000339764.1.62120 WP_000339764.1.62122 WP_000339764.1.62204 WP_000339764.1.62219 WP_000339764.1.62241 WP_000339764.1.62257 WP_000339764.1.62271 WP_000339764.1.62304 WP_000339764.1.62339 WP_000339764.1.62364 WP_000339764.1.62374 WP_000339764.1.62403 WP_000339764.1.62504 WP_000339764.1.62522 WP_000339764.1.6253 WP_000339764.1.62798 WP_000339764.1.62853 WP_000339764.1.62903 WP_000339764.1.62910 WP_000339764.1.62955 WP_000339764.1.62976 WP_000339764.1.63118 WP_000339764.1.63135 WP_000339764.1.63150 WP_000339764.1.63181 WP_000339764.1.63186 WP_000339764.1.63203 WP_000339764.1.63250 WP_000339764.1.63256 WP_000339764.1.63290 WP_000339764.1.63382 WP_000339764.1.63432 WP_000339764.1.63455 WP_000339764.1.63461 WP_000339764.1.63479 WP_000339764.1.63532 WP_000339764.1.63568 WP_000339764.1.6357 WP_000339764.1.63577 WP_000339764.1.63664 WP_000339764.1.63677 WP_000339764.1.63718 WP_000339764.1.6375 WP_000339764.1.63757 WP_000339764.1.63797 WP_000339764.1.63831 WP_000339764.1.63834 WP_000339764.1.63903 WP_000339764.1.63934 WP_000339764.1.64007 WP_000339764.1.64018 WP_000339764.1.64046 WP_000339764.1.6423 WP_000339764.1.64244 WP_000339764.1.64266 WP_000339764.1.6437 WP_000339764.1.64374 WP_000339764.1.64387 WP_000339764.1.64403 WP_000339764.1.64649 WP_000339764.1.64667 WP_000339764.1.64690 WP_000339764.1.64702 WP_000339764.1.64757 WP_000339764.1.64781 WP_000339764.1.64831 WP_000339764.1.6489 WP_000339764.1.64894 WP_000339764.1.64919 WP_000339764.1.64920 WP_000339764.1.65016 WP_000339764.1.65018 WP_000339764.1.65027 WP_000339764.1.65028 WP_000339764.1.65163 WP_000339764.1.65171 WP_000339764.1.65248 WP_000339764.1.65269 WP_000339764.1.65295 WP_000339764.1.65348 WP_000339764.1.6535 WP_000339764.1.65437 WP_000339764.1.65474 WP_000339764.1.65633 WP_000339764.1.6565 WP_000339764.1.65696 WP_000339764.1.6572 WP_000339764.1.6575 WP_000339764.1.65782 WP_000339764.1.65795 WP_000339764.1.65940 WP_000339764.1.65956 WP_000339764.1.66049 WP_000339764.1.66235 WP_000339764.1.66270 WP_000339764.1.66272 WP_000339764.1.6630 WP_000339764.1.66314 WP_000339764.1.66330 WP_000339764.1.66358 WP_000339764.1.66362 WP_000339764.1.66368 WP_000339764.1.6638 WP_000339764.1.6640 WP_000339764.1.66492 WP_000339764.1.66630 WP_000339764.1.66678 WP_000339764.1.66698 WP_000339764.1.6680 WP_000339764.1.66800 WP_000339764.1.66807 WP_000339764.1.66825 WP_000339764.1.66834 WP_000339764.1.66901 WP_000339764.1.66962 WP_000339764.1.67 WP_000339764.1.67037 WP_000339764.1.67045 WP_000339764.1.67100 WP_000339764.1.67181 WP_000339764.1.67235 WP_000339764.1.67268 WP_000339764.1.67288 WP_000339764.1.67347 WP_000339764.1.6739 WP_000339764.1.67465 WP_000339764.1.67552 WP_000339764.1.67617 WP_000339764.1.67633 WP_000339764.1.67682 WP_000339764.1.67803 WP_000339764.1.67827 WP_000339764.1.67829 WP_000339764.1.67887 WP_000339764.1.67924 WP_000339764.1.68036 WP_000339764.1.68073 WP_000339764.1.6809 WP_000339764.1.68167 WP_000339764.1.68201 WP_000339764.1.68206 WP_000339764.1.6827 WP_000339764.1.68275 WP_000339764.1.6833 WP_000339764.1.68401 WP_000339764.1.68477 WP_000339764.1.6849 WP_000339764.1.68532 WP_000339764.1.68547 WP_000339764.1.68589 WP_000339764.1.68591 WP_000339764.1.68629 WP_000339764.1.68655 WP_000339764.1.68656 WP_000339764.1.6875 WP_000339764.1.68778 WP_000339764.1.68787 WP_000339764.1.68816 WP_000339764.1.6882 WP_000339764.1.68894 WP_000339764.1.68928 WP_000339764.1.68975 WP_000339764.1.69001 WP_000339764.1.69006 WP_000339764.1.6904 WP_000339764.1.6913 WP_000339764.1.69139 WP_000339764.1.69146 WP_000339764.1.69151 WP_000339764.1.69255 WP_000339764.1.69296 WP_000339764.1.69359 WP_000339764.1.69371 WP_000339764.1.69397 WP_000339764.1.69465 WP_000339764.1.6954 WP_000339764.1.69564 WP_000339764.1.69636 WP_000339764.1.69644 WP_000339764.1.69704 WP_000339764.1.69710 WP_000339764.1.69758 WP_000339764.1.69760 WP_000339764.1.69785 WP_000339764.1.69808 WP_000339764.1.69848 WP_000339764.1.69975 WP_000339764.1.70047 WP_000339764.1.7021 WP_000339764.1.70241 WP_000339764.1.70248 WP_000339764.1.70269 WP_000339764.1.70289 WP_000339764.1.70321 WP_000339764.1.70447 WP_000339764.1.70485 WP_000339764.1.70488 WP_000339764.1.70491 WP_000339764.1.70580 WP_000339764.1.70643 WP_000339764.1.70683 WP_000339764.1.70883 WP_000339764.1.70922 WP_000339764.1.70948 WP_000339764.1.70959 WP_000339764.1.71023 WP_000339764.1.7110 WP_000339764.1.71116 WP_000339764.1.71146 WP_000339764.1.71165 WP_000339764.1.71188 WP_000339764.1.71202 WP_000339764.1.71243 WP_000339764.1.71299 WP_000339764.1.71306 WP_000339764.1.71337 WP_000339764.1.71363 WP_000339764.1.71368 WP_000339764.1.71378 WP_000339764.1.71401 WP_000339764.1.71446 WP_000339764.1.71452 WP_000339764.1.71636 WP_000339764.1.71667 WP_000339764.1.71702 WP_000339764.1.7174 WP_000339764.1.71750 WP_000339764.1.71756 WP_000339764.1.71798 WP_000339764.1.71845 WP_000339764.1.71881 WP_000339764.1.71908 WP_000339764.1.71923 WP_000339764.1.71952 WP_000339764.1.71973 WP_000339764.1.72105 WP_000339764.1.72203 WP_000339764.1.72226 WP_000339764.1.72283 WP_000339764.1.72376 WP_000339764.1.72382 WP_000339764.1.72403 WP_000339764.1.7243 WP_000339764.1.72594 WP_000339764.1.72642 WP_000339764.1.72689 WP_000339764.1.72728 WP_000339764.1.72827 WP_000339764.1.72843 WP_000339764.1.72850 WP_000339764.1.72871 WP_000339764.1.72892 WP_000339764.1.72944 WP_000339764.1.72975 WP_000339764.1.73125 WP_000339764.1.7315 WP_000339764.1.73200 WP_000339764.1.73328 WP_000339764.1.7334 WP_000339764.1.73377 WP_000339764.1.73461 WP_000339764.1.73481 WP_000339764.1.73535 WP_000339764.1.7356 WP_000339764.1.73581 WP_000339764.1.73617 WP_000339764.1.73669 WP_000339764.1.7374 WP_000339764.1.73753 WP_000339764.1.73758 WP_000339764.1.73794 WP_000339764.1.73831 WP_000339764.1.73847 WP_000339764.1.7386 WP_000339764.1.7387 WP_000339764.1.73924 WP_000339764.1.73956 WP_000339764.1.73965 WP_000339764.1.74028 WP_000339764.1.74029 WP_000339764.1.74117 WP_000339764.1.74181 WP_000339764.1.74191 WP_000339764.1.7433 WP_000339764.1.74379 WP_000339764.1.74410 WP_000339764.1.74418 WP_000339764.1.7444 WP_000339764.1.74466 WP_000339764.1.745 WP_000339764.1.74529 WP_000339764.1.74545 WP_000339764.1.74644 WP_000339764.1.74661 WP_000339764.1.74702 WP_000339764.1.74745 WP_000339764.1.7491 WP_000339764.1.74946 WP_000339764.1.74992 WP_000339764.1.75009 WP_000339764.1.75129 WP_000339764.1.75187 WP_000339764.1.75288 WP_000339764.1.75334 WP_000339764.1.75362 WP_000339764.1.75385 WP_000339764.1.75392 WP_000339764.1.75402 WP_000339764.1.7543 WP_000339764.1.75494 WP_000339764.1.75585 WP_000339764.1.75609 WP_000339764.1.75626 WP_000339764.1.75760 WP_000339764.1.75764 WP_000339764.1.75837 WP_000339764.1.75874 WP_000339764.1.75884 WP_000339764.1.75932 WP_000339764.1.75945 WP_000339764.1.76 WP_000339764.1.76020 WP_000339764.1.76024 WP_000339764.1.76097 WP_000339764.1.76164 WP_000339764.1.76252 WP_000339764.1.76301 WP_000339764.1.76327 WP_000339764.1.7634 WP_000339764.1.76364 WP_000339764.1.76434 WP_000339764.1.76445 WP_000339764.1.76548 WP_000339764.1.7655 WP_000339764.1.76576 WP_000339764.1.7660 WP_000339764.1.76673 WP_000339764.1.76706 WP_000339764.1.76721 WP_000339764.1.76756 WP_000339764.1.76760 WP_000339764.1.76806 WP_000339764.1.76875 WP_000339764.1.76880 WP_000339764.1.76899 WP_000339764.1.77038 WP_000339764.1.77047 WP_000339764.1.77080 WP_000339764.1.7712 WP_000339764.1.77177 WP_000339764.1.77180 WP_000339764.1.77244 WP_000339764.1.77267 WP_000339764.1.77271 WP_000339764.1.77292 WP_000339764.1.77313 WP_000339764.1.77349 WP_000339764.1.77390 WP_000339764.1.77414 WP_000339764.1.77431 WP_000339764.1.77440 WP_000339764.1.77514 WP_000339764.1.77529 WP_000339764.1.77549 WP_000339764.1.77629 WP_000339764.1.77646 WP_000339764.1.77692 WP_000339764.1.77710 WP_000339764.1.77729 WP_000339764.1.7782 WP_000339764.1.77846 WP_000339764.1.77851 WP_000339764.1.77898 WP_000339764.1.77918 WP_000339764.1.77960 WP_000339764.1.78026 WP_000339764.1.78033 WP_000339764.1.78076 WP_000339764.1.78096 WP_000339764.1.78100 WP_000339764.1.78110 WP_000339764.1.78120 WP_000339764.1.78201 WP_000339764.1.78245 WP_000339764.1.78259 WP_000339764.1.78301 WP_000339764.1.78372 WP_000339764.1.78383 WP_000339764.1.78407 WP_000339764.1.7861 WP_000339764.1.78618 WP_000339764.1.78673 WP_000339764.1.78735 WP_000339764.1.78738 WP_000339764.1.78802 WP_000339764.1.78830 WP_000339764.1.78835 WP_000339764.1.78838 WP_000339764.1.78871 WP_000339764.1.78874 WP_000339764.1.78918 WP_000339764.1.78930 WP_000339764.1.79032 WP_000339764.1.79081 WP_000339764.1.79151 WP_000339764.1.79167 WP_000339764.1.79235 WP_000339764.1.79302 WP_000339764.1.79335 WP_000339764.1.79462 WP_000339764.1.79472 WP_000339764.1.79490 WP_000339764.1.79495 WP_000339764.1.79529 WP_000339764.1.79570 WP_000339764.1.7964 WP_000339764.1.79642 WP_000339764.1.79645 WP_000339764.1.79659 WP_000339764.1.79668 WP_000339764.1.79708 WP_000339764.1.79734 WP_000339764.1.79845 WP_000339764.1.79945 WP_000339764.1.79966 WP_000339764.1.80077 WP_000339764.1.80137 WP_000339764.1.80182 WP_000339764.1.80296 WP_000339764.1.80333 WP_000339764.1.80366 WP_000339764.1.80529 WP_000339764.1.80586 WP_000339764.1.80638 WP_000339764.1.80651 WP_000339764.1.80667 WP_000339764.1.80674 WP_000339764.1.80741 WP_000339764.1.80750 WP_000339764.1.80780 WP_000339764.1.80819 WP_000339764.1.80831 WP_000339764.1.80850 WP_000339764.1.80881 WP_000339764.1.80927 WP_000339764.1.80939 WP_000339764.1.8096 WP_000339764.1.80973 WP_000339764.1.81037 WP_000339764.1.81062 WP_000339764.1.81067 WP_000339764.1.81069 WP_000339764.1.81149 WP_000339764.1.81175 WP_000339764.1.8119 WP_000339764.1.81193 WP_000339764.1.81231 WP_000339764.1.81305 WP_000339764.1.81320 WP_000339764.1.81321 WP_000339764.1.81328 WP_000339764.1.81354 WP_000339764.1.81409 WP_000339764.1.81425 WP_000339764.1.81472 WP_000339764.1.81504 WP_000339764.1.81528 WP_000339764.1.81548 WP_000339764.1.8168 WP_000339764.1.81735 WP_000339764.1.81746 WP_000339764.1.81750 WP_000339764.1.81760 WP_000339764.1.81785 WP_000339764.1.81902 WP_000339764.1.81974 WP_000339764.1.81977 WP_000339764.1.81995 WP_000339764.1.82192 WP_000339764.1.82232 WP_000339764.1.82258 WP_000339764.1.82269 WP_000339764.1.82337 WP_000339764.1.8236 WP_000339764.1.82369 WP_000339764.1.82395 WP_000339764.1.82464 WP_000339764.1.82479 WP_000339764.1.82503 WP_000339764.1.82515 WP_000339764.1.82529 WP_000339764.1.82636 WP_000339764.1.82676 WP_000339764.1.82761 WP_000339764.1.8282 WP_000339764.1.82841 WP_000339764.1.82908 WP_000339764.1.82937 WP_000339764.1.82944 WP_000339764.1.82946 WP_000339764.1.82956 WP_000339764.1.83092 WP_000339764.1.83119 WP_000339764.1.83139 WP_000339764.1.83163 WP_000339764.1.83221 WP_000339764.1.83252 WP_000339764.1.83305 WP_000339764.1.83378 WP_000339764.1.83413 WP_000339764.1.83491 WP_000339764.1.83523 WP_000339764.1.8354 WP_000339764.1.83598 WP_000339764.1.83650 WP_000339764.1.83721 WP_000339764.1.83739 WP_000339764.1.83760 WP_000339764.1.83854 WP_000339764.1.83897 WP_000339764.1.83960 WP_000339764.1.83979 WP_000339764.1.83995 WP_000339764.1.84031 WP_000339764.1.84103 WP_000339764.1.84168 WP_000339764.1.84179 WP_000339764.1.84283 WP_000339764.1.84291 WP_000339764.1.84355 WP_000339764.1.84392 WP_000339764.1.84397 WP_000339764.1.8441 WP_000339764.1.84461 WP_000339764.1.84475 WP_000339764.1.84532 WP_000339764.1.84554 WP_000339764.1.84659 WP_000339764.1.84683 WP_000339764.1.84899 WP_000339764.1.849 WP_000339764.1.8497 WP_000339764.1.85040 WP_000339764.1.85094 WP_000339764.1.85134 WP_000339764.1.85178 WP_000339764.1.85190 WP_000339764.1.8533 WP_000339764.1.85433 WP_000339764.1.8545 WP_000339764.1.85469 WP_000339764.1.85481 WP_000339764.1.85483 WP_000339764.1.85541 WP_000339764.1.8556 WP_000339764.1.85568 WP_000339764.1.85615 WP_000339764.1.85617 WP_000339764.1.85663 WP_000339764.1.85671 WP_000339764.1.85672 WP_000339764.1.85675 WP_000339764.1.85777 WP_000339764.1.85886 WP_000339764.1.85900 WP_000339764.1.85904 WP_000339764.1.85976 WP_000339764.1.86007 WP_000339764.1.86043 WP_000339764.1.86173 WP_000339764.1.86306 WP_000339764.1.86310 WP_000339764.1.86335 WP_000339764.1.86356 WP_000339764.1.86450 WP_000339764.1.86453 WP_000339764.1.86469 WP_000339764.1.86580 WP_000339764.1.86588 WP_000339764.1.86601 WP_000339764.1.86661 WP_000339764.1.86699 WP_000339764.1.8671 WP_000339764.1.8672 WP_000339764.1.86744 WP_000339764.1.8678 WP_000339764.1.86810 WP_000339764.1.8684 WP_000339764.1.86895 WP_000339764.1.86902 WP_000339764.1.86906 WP_000339764.1.87095 WP_000339764.1.87143 WP_000339764.1.87283 WP_000339764.1.87323 WP_000339764.1.8736 WP_000339764.1.87460 WP_000339764.1.87493 WP_000339764.1.87552 WP_000339764.1.87584 WP_000339764.1.8767 WP_000339764.1.87695 WP_000339764.1.87779 WP_000339764.1.87875 WP_000339764.1.87899 WP_000339764.1.8792 WP_000339764.1.87945 WP_000339764.1.88019 WP_000339764.1.88073 WP_000339764.1.8809 WP_000339764.1.88092 WP_000339764.1.88165 WP_000339764.1.88174 WP_000339764.1.88222 WP_000339764.1.88244 WP_000339764.1.88291 WP_000339764.1.88293 WP_000339764.1.88303 WP_000339764.1.8837 WP_000339764.1.88393 WP_000339764.1.88423 WP_000339764.1.88483 WP_000339764.1.88620 WP_000339764.1.88624 WP_000339764.1.88651 WP_000339764.1.88703 WP_000339764.1.88792 WP_000339764.1.88902 WP_000339764.1.8891 WP_000339764.1.88957 WP_000339764.1.88980 WP_000339764.1.88981 WP_000339764.1.88995 WP_000339764.1.89008 WP_000339764.1.89054 WP_000339764.1.89114 WP_000339764.1.89116 WP_000339764.1.89119 WP_000339764.1.89138 WP_000339764.1.89174 WP_000339764.1.89188 WP_000339764.1.89215 WP_000339764.1.89304 WP_000339764.1.89452 WP_000339764.1.89512 WP_000339764.1.89527 WP_000339764.1.89570 WP_000339764.1.89604 WP_000339764.1.89622 WP_000339764.1.89647 WP_000339764.1.89657 WP_000339764.1.89659 WP_000339764.1.89765 WP_000339764.1.89777 WP_000339764.1.89815 WP_000339764.1.89817 WP_000339764.1.89902 WP_000339764.1.8996 WP_000339764.1.89965 WP_000339764.1.89975 WP_000339764.1.9002 WP_000339764.1.90033 WP_000339764.1.90097 WP_000339764.1.90252 WP_000339764.1.90363 WP_000339764.1.90417 WP_000339764.1.90453 WP_000339764.1.90458 WP_000339764.1.90472 WP_000339764.1.90557 WP_000339764.1.90585 WP_000339764.1.90641 WP_000339764.1.90734 WP_000339764.1.90792 WP_000339764.1.90876 WP_000339764.1.90984 WP_000339764.1.91003 WP_000339764.1.91056 WP_000339764.1.91069 WP_000339764.1.91179 WP_000339764.1.91278 WP_000339764.1.91459 WP_000339764.1.91470 WP_000339764.1.91512 WP_000339764.1.91564 WP_000339764.1.91580 WP_000339764.1.91621 WP_000339764.1.91625 WP_000339764.1.91628 WP_000339764.1.91655 WP_000339764.1.91724 WP_000339764.1.91732 WP_000339764.1.91736 WP_000339764.1.91788 WP_000339764.1.91903 WP_000339764.1.92013 WP_000339764.1.92039 WP_000339764.1.92093 WP_000339764.1.92108 WP_000339764.1.92165 WP_000339764.1.92183 WP_000339764.1.92208 WP_000339764.1.92213 WP_000339764.1.92268 WP_000339764.1.92299 WP_000339764.1.92310 WP_000339764.1.92411 WP_000339764.1.92443 WP_000339764.1.92482 WP_000339764.1.92531 WP_000339764.1.92575 WP_000339764.1.92669 WP_000339764.1.92671 WP_000339764.1.92729 WP_000339764.1.92738 WP_000339764.1.92879 WP_000339764.1.92893 WP_000339764.1.92939 WP_000339764.1.92975 WP_000339764.1.93059 WP_000339764.1.93086 WP_000339764.1.93101 WP_000339764.1.93136 WP_000339764.1.93155 WP_000339764.1.93339 WP_000339764.1.93365 WP_000339764.1.93543 WP_000339764.1.93604 WP_000339764.1.93650 WP_000339764.1.93656 WP_000339764.1.93662 WP_000339764.1.937 WP_000339764.1.93705 WP_000339764.1.93803 WP_000339764.1.93804 WP_000339764.1.93837 WP_000339764.1.9389 WP_000339764.1.93937 WP_000339764.1.93994 WP_000339764.1.94064 WP_000339764.1.94070 WP_000339764.1.94072 WP_000339764.1.94132 WP_000339764.1.94162 WP_000339764.1.94168 WP_000339764.1.94198 WP_000339764.1.9432 WP_000339764.1.94354 WP_000339764.1.94380 WP_000339764.1.94383 WP_000339764.1.94458 WP_000339764.1.94565 WP_000339764.1.94584 WP_000339764.1.94655 WP_000339764.1.94674 WP_000339764.1.94796 WP_000339764.1.94947 WP_000339764.1.94959 WP_000339764.1.94967 WP_000339764.1.94987 WP_000339764.1.95051 WP_000339764.1.95085 WP_000339764.1.95094 WP_000339764.1.95121 WP_000339764.1.95152 WP_000339764.1.95171 WP_000339764.1.95248 WP_000339764.1.95277 WP_000339764.1.95282 WP_000339764.1.95320 WP_000339764.1.95388 WP_000339764.1.95404 WP_000339764.1.95546 WP_000339764.1.95630 WP_000339764.1.95641 WP_000339764.1.95670 WP_000339764.1.95691 WP_000339764.1.95701 WP_000339764.1.95805 WP_000339764.1.95826 WP_000339764.1.95911 WP_000339764.1.95939 WP_000339764.1.95940 WP_000339764.1.96004 WP_000339764.1.96139 WP_000339764.1.96162 WP_000339764.1.96190 WP_000339764.1.96317 WP_000339764.1.96335 WP_000339764.1.96343 WP_000339764.1.96429 WP_000339764.1.9644 WP_000339764.1.96469 WP_000339764.1.96500 WP_000339764.1.96555 WP_000339764.1.96563 WP_000339764.1.96640 WP_000339764.1.96732 WP_000339764.1.9674 WP_000339764.1.96771 WP_000339764.1.96810 WP_000339764.1.9686 WP_000339764.1.96890 WP_000339764.1.96902 WP_000339764.1.97015 WP_000339764.1.97043 WP_000339764.1.97047 WP_000339764.1.97089 WP_000339764.1.97109 WP_000339764.1.97143 WP_000339764.1.97145 WP_000339764.1.97190 WP_000339764.1.97297 WP_000339764.1.97318 WP_000339764.1.97337 WP_000339764.1.97369 WP_000339764.1.97386 WP_000339764.1.97413 WP_000339764.1.97477 WP_000339764.1.97487 WP_000339764.1.97594 WP_000339764.1.97597 WP_000339764.1.97613 WP_000339764.1.97620 WP_000339764.1.97626 WP_000339764.1.97628 WP_000339764.1.97631 WP_000339764.1.97693 WP_000339764.1.97725 WP_000339764.1.97727 WP_000339764.1.97732 WP_000339764.1.97736 WP_000339764.1.9775 WP_000339764.1.97768 WP_000339764.1.97772 WP_000339764.1.97846 WP_000339764.1.97873 WP_000339764.1.9799 WP_000339764.1.98006 WP_000339764.1.98019 WP_000339764.1.98022 WP_000339764.1.9805 WP_000339764.1.98107 WP_000339764.1.98110 WP_000339764.1.98146 WP_000339764.1.98170 WP_000339764.1.98219 WP_000339764.1.9826 WP_000339764.1.98314 WP_000339764.1.9841 WP_000339764.1.98446 WP_000339764.1.98495 WP_000339764.1.98531 WP_000339764.1.98551 WP_000339764.1.98577 WP_000339764.1.98634 WP_000339764.1.98676 WP_000339764.1.98677 WP_000339764.1.98760 WP_000339764.1.98843 WP_000339764.1.98899 WP_000339764.1.98947 WP_000339764.1.9898 WP_000339764.1.99040 WP_000339764.1.99098 WP_000339764.1.99184 WP_000339764.1.9919 WP_000339764.1.99197 WP_000339764.1.99219 WP_000339764.1.99255 WP_000339764.1.99267 WP_000339764.1.99276 WP_000339764.1.99327 WP_000339764.1.99339 WP_000339764.1.9954 WP_000339764.1.99626 WP_000339764.1.99646 WP_000339764.1.99657 WP_000339764.1.99660 WP_000339764.1.99712 WP_000339764.1.99813 WP_000339764.1.99858 WP_000339764.1.99889 WP_000339764.1.99958 gi|378701844|ref|YP_005183802.1| gi|409247656|ref|YP_006888352.1| gi|538364562|ref|YP_008507847.1| gi|550903347|ref|YP_008672439.1| gi|525839994|ref|YP_008257418.1| APC24107 StR172 gi|383498586|ref|YP_005399275.1| gi|525948966|ref|YP_008310743.1| gi|378452884|ref|YP_005240244.1| gi|386589343|ref|YP_006085743.1| gi|378447322|ref|YP_005234954.1| gi|526218186|ref|YP_008263287.1| gi|16767248|ref|NP_462863.1| gi|378986668|ref|YP_005249824.1| gi|549726510|ref|YP_008646700.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]