SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|28870958|ref|NP_793577.1| from Pseudomonas syringae pv. tomato str. DC3000

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|28870958|ref|NP_793577.1|
Domain Number 1 Region: 4-365
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 4.51e-110
Family FMN-linked oxidoreductases 0.00000000232
Further Details:      
 
Domain Number 2 Region: 336-524
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 2.35e-42
Family N-terminal domain of adrenodoxin reductase-like 0.00000893
Further Details:      
 
Domain Number 3 Region: 465-523,561-657
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.53e-22
Family C-terminal domain of adrenodoxin reductase-like 0.0000483
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|28870958|ref|NP_793577.1|
Sequence length 679
Comment 2,4-dienoyl-CoA reductase [Pseudomonas syringae pv. tomato str. DC3000]
Sequence
MTAAHYPHLLAPLDLGFTTLRNRTLMGSMHTGLEERPGGFERMAAYFAERARGGVGLMVT
GGIAPNEEGGVYDGAAKLTNAQEAEQHRIVTQAVHEAGGKICLQILHAGRYAYSRKQVAP
SAIQAPINPFTPRELDEEGIEKQIADFVNCSTLARSAGYDGVEIMGSEGYFINQFLAAHT
NHRTDRWGGSYENRMRLAVEIVTRVREAVSADFIIIFRLSMLDLVAGGSSWQEIVQLAKA
VEQAGATLINTGIGWHEARIPTIATKVPRAAFSKVTAKLRGSVNVPLITTNRINTAEVAE
RILSEGDADMVSMARPFLADPEFVNKAAAGHAERINTCIGCNQACLDHTFGGKLTSCLVN
PRACHETELNYLPVLQIKKIAVVGAGPAGLAAATVAAQRGHEVTLFDSASEIGGQFNIAK
RVPGKEEFSETLRYFRNKMQETGVQLRLGTRVKAQDLLGAGFDEVILATGIAPRTPAIPG
IDNPKVLSYLDVILQRKPVGRSVAVIGAGGIGFDVSEFLVHQGVATSLDRDAFWKEWGID
TTLEARGGVAGIKPDVHAPARQVFLLQRKHSKVGDGLGKTTGWIHRTGLKNKQVQMLNGV
QYLKIDDAGLHIRIGEDGEETLLAVDNIVICAGQDPLRELYDDLVTAGQSVHLIGGADVA
AELDAKRAIDQGSRLAAAL
Download sequence
Identical sequences Q87YJ3
gi|28870958|ref|NP_793577.1| 223283.PSPTO_3803 NP_793577.1.37326 WP_011104734.1.14276 WP_011104734.1.17870 WP_011104734.1.6959

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]