SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|28869703|ref|NP_792322.1| from Pseudomonas syringae pv. tomato str. DC3000

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|28869703|ref|NP_792322.1|
Domain Number 1 Region: 357-559
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 8.04e-59
Family Pyruvate oxidase and decarboxylase PP module 0.0004
Further Details:      
 
Domain Number 2 Region: 2-178
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.15e-45
Family Pyruvate oxidase and decarboxylase Pyr module 0.0000491
Further Details:      
 
Domain Number 3 Region: 180-351
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 1.18e-42
Family Pyruvate oxidase and decarboxylase, middle domain 0.00087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|28869703|ref|NP_792322.1|
Sequence length 572
Comment pyruvate dehydrogenase [Pseudomonas syringae pv. tomato str. DC3000]
Sequence
MSKTIADHLAQTLAAAGVSHIWGVSGDSLNGLTDSLERIDSINWMHTRHEEVAAFAAGAQ
AASSGKLAVCAGSCGPGNLHLINGLYDCHRNRVPVLAIAAHIPSSEIGLDYFQETHPQEL
FKECSHFVELVSNPEQFPRVLERAMRAAISQKGVAVIVLPGDVALSESPDVPAKWVEATP
PVVVPADTDLQSMANMLNDSKAVTLLCGAGCAGAHEQILALADTLGAPIVHALRGKQHVE
YDNPFDVGMTGLIGFSSGYHAMLSCDTLVILGSSFPYRNFYPEKANIIQIDLDPTQLGRR
TPVALGLVGGVRETLDALQPKLKPHTDRRFLDKALKHYAKAREDLDELATPTPNGTPIHP
QYLTRLVDEQADADAIFTVDVGTPTLWAARYLHMNGKRSLLGSFNHGSMANALPQALGAK
AEHPDRQVVALCGDGGLSMLLGDLLSIRQLNLPIKMVVFNNSSLGFVDMEMKASGYVPHG
TDLHETNFAGIALGAGILGLRVENAEELPAALRKAFDHPGPVLIDVVTAKQELGIPPKIK
LAQAKGFSLYMMRAIMSGRGSEVLELAKTNLR
Download sequence
Identical sequences A0A0N0FJF4 A0A0P9JU19 A0A0Q0BKE0 A0A0Q0C8U3 A0A1H3U2X0 Q882W2
223283.PSPTO_2510 NP_792322.1.37326 WP_011104047.1.11497 WP_011104047.1.14276 WP_011104047.1.17870 WP_011104047.1.45653 WP_011104047.1.60779 WP_011104047.1.60793 WP_011104047.1.62491 WP_011104047.1.6959 WP_011104047.1.7265 WP_011104047.1.80269 WP_011104047.1.92774 gi|28869703|ref|NP_792322.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]