SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|94987971|ref|YP_596072.1| from Streptococcus pyogenes MGAS9429

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|94987971|ref|YP_596072.1|
Domain Number 1 Region: 1-209
Classification Level Classification E-value
Superfamily CutC-like 2.62e-57
Family CutC-like 0.0000566
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|94987971|ref|YP_596072.1|
Sequence length 209
Comment copper homeostasis protein [Streptococcus pyogenes MGAS9429]
Sequence
MIKEFCAENLTLLPTLDAGQVSRVELCDNLAVGGTTPSYGVIKEACQLLHDKKISVATMI
RPRGGDFVYNDLELKAMEEDILKAVEAGSDALVLGLLTTENHLDTDAIEQLLPATQGLPL
VFHMAFDHIPTDHQHQALDQLIDYGFVRVLTHGSPEATPITDNVEQLKSLVTYANKRIEI
MIGGGVTAENCQNLSQLTGTAIVHGTKII
Download sequence
Identical sequences Q1JN71
gi|94991854|ref|YP_599953.1| gi|94987971|ref|YP_596072.1| 370551.MGAS9429_Spy0340 370553.MGAS2096_Spy0357 WP_002990900.1.100536 WP_002990900.1.100577 WP_002990900.1.100847 WP_002990900.1.101138 WP_002990900.1.102005 WP_002990900.1.1042 WP_002990900.1.1208 WP_002990900.1.12667 WP_002990900.1.13499 WP_002990900.1.13702 WP_002990900.1.15156 WP_002990900.1.15301 WP_002990900.1.19566 WP_002990900.1.19969 WP_002990900.1.20957 WP_002990900.1.21420 WP_002990900.1.22005 WP_002990900.1.22610 WP_002990900.1.2271 WP_002990900.1.23879 WP_002990900.1.25243 WP_002990900.1.27012 WP_002990900.1.27947 WP_002990900.1.29586 WP_002990900.1.35416 WP_002990900.1.35765 WP_002990900.1.37580 WP_002990900.1.39950 WP_002990900.1.4028 WP_002990900.1.41304 WP_002990900.1.45887 WP_002990900.1.46237 WP_002990900.1.46364 WP_002990900.1.49289 WP_002990900.1.5255 WP_002990900.1.54255 WP_002990900.1.55020 WP_002990900.1.59139 WP_002990900.1.5959 WP_002990900.1.59712 WP_002990900.1.60435 WP_002990900.1.61127 WP_002990900.1.62083 WP_002990900.1.65831 WP_002990900.1.68080 WP_002990900.1.69338 WP_002990900.1.69536 WP_002990900.1.69602 WP_002990900.1.70332 WP_002990900.1.70768 WP_002990900.1.71274 WP_002990900.1.72175 WP_002990900.1.72799 WP_002990900.1.75746 WP_002990900.1.75979 WP_002990900.1.77464 WP_002990900.1.77721 WP_002990900.1.80116 WP_002990900.1.80675 WP_002990900.1.83949 WP_002990900.1.84888 WP_002990900.1.85790 WP_002990900.1.86840 WP_002990900.1.87115 WP_002990900.1.88297 WP_002990900.1.91031 WP_002990900.1.91222 WP_002990900.1.93887 WP_002990900.1.94658 WP_002990900.1.94792 WP_002990900.1.97076 WP_002990900.1.98562 WP_002990900.1.99282 WP_002990900.1.99582 WP_002990900.1.99639

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]