SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|94988364|ref|YP_596465.1| from Streptococcus pyogenes MGAS9429

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|94988364|ref|YP_596465.1|
Domain Number 1 Region: 40-376
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 1.52e-55
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain 0.014
Further Details:      
 
Domain Number 2 Region: 379-567
Classification Level Classification E-value
Superfamily 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 1.31e-39
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|94988364|ref|YP_596465.1|
Sequence length 683
Comment 5'-nucleotidase [Streptococcus pyogenes MGAS9429]
Sequence
MIYNDYVNLLGDFMKKYFILKSSVLSILTSFTLLVTDVQADQVDVQFLGVNDFHGALDNT
GTAYTPSGKIPNAGTAAQLGAYMDDAEIDFKQANQDGTSIRVQAGDMVGASPANSALLQD
EPTVKVFNKMKFEYGTLGNHEFDEGLDEFNRIMTGQAPDPESTINDITKQYEHEASHQTI
VIANVIDKKTNDIPYGWKPYAIKDIAINDKIVKIGFIGVVTTEIPNLVLKQNYEHYQFLD
VAETIAKYAKELQEQHVHAIVVLAHIPATSKDGVVDHEMATVMEKVNQIYPEHSIDIIFA
GHNHQYTNGTIGKTRIVQALSQGKAYADVRGTLDTDTNDFIKTPSANVVAVAPGIKTENS
DIKAIINHANDIVKTVTERKIGTATNSSTISKTENIDKESPVGNLVTTAQLTIAKKTFPT
VDFAMTNNGGIRSDLVVKNDRTITWGAAQAVQPFGNILQVIQMTGQHIYDVLNQQYDENQ
TYFLQMSGLTYTYTDNDPKNSDTPFKIVKVYKDNGEEINLTTTYTVVVNDFLYGGGDGFS
AFKKAKLVGAINTDTEAFITYITNLQASGKTVNATIKGVKNYVTSNLERSTKINSAGKHS
IISKVFRNRDGNIVSSEVISDLLTSTENTNNSFGKKETTTNKNTISNSTLPITGDNYKMS
PIMTILALISLGGLNAFIKKRKS
Download sequence
Identical sequences Q1JM91
370551.MGAS9429_Spy0733 370553.MGAS2096_Spy0749 gi|94992246|ref|YP_600345.1| gi|94988364|ref|YP_596465.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]