SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|118577356|ref|YP_899596.1|NC_008607 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|118577356|ref|YP_899596.1|NC_008607
Domain Number 1 Region: 4-175
Classification Level Classification E-value
Superfamily CheY-like 5.42e-34
Family CheY-related 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|118577356|ref|YP_899596.1|NC_008607
Sequence length 224
Comment two component transcriptional regulator [Pelobacter propionicus DSM 2379 plasmid pPRO1]
Sequence
MKYLLIEDERKIAGFIKRGLEEGNCQVVIVGDGAEGLRLAQTGEYALVILDLGIPEIDGL
SVLKELRSTGNQVPVLILTARKLPEEVVAGLEAGSDDYMGKPFAFRELRARIAALLRRAG
RNRGSEVVFGELKLDPVTHRFWRSGNEISLSEKEYCLMEYMIRNPNQILTRSMIASNCWV
NTFEGKFSNIIDVYVTYLRRKVDVGYPTKMIHTVRGKGYILREY
Download sequence
Identical sequences A0R7V0
338966.Ppro_3752 gi|118577356|ref|YP_899596.1|NC_008607 WP_011733862.1.31684 gi|118577356|ref|YP_899596.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]