SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|13488378|ref|NP_109385.1|NC_002682 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|13488378|ref|NP_109385.1|NC_002682
Domain Number 1 Region: 150-337
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 2.22e-58
Family Methylesterase CheB, C-terminal domain 0.0000603
Further Details:      
 
Domain Number 2 Region: 1-101
Classification Level Classification E-value
Superfamily CheY-like 1.42e-20
Family CheY-related 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|13488378|ref|NP_109385.1|NC_002682
Sequence length 339
Comment chemotaxis-specific methylesterase [Mesorhizobium loti MAFF303099 plasmid pMLb]
Sequence
MRIGVVNDMPMAVELLRRLVLSTGEHQVAWIATNGREAVEVCRRDLPDLILMDLAMPVMD
GVEATRRIMAETPCSILLVTASIESNLADVYEAMGHGALDAVDIPSVGIEGNASSQSARL
LTNKIATIGKLIGDAPTKAKRRMSRAAEPTPRRLIAIGASAGGPAAVAAVLSAFPVDFGG
AIVLVQHLDAQFVPGLVDWLGQHTPLPIRPARERDSPQAGTVLVASSADHLVFKSVQQLG
YTPSPKDNVYRPSVDVFFESAAQWWPGSVIGVLLTGMGRDGARGLRQLRDKGHLTIAQDR
ATSAVYGMPKAAADIGAAVDILPLSAIGSRIIEACERST
Download sequence
Identical sequences Q98PD1
gi|13488378|ref|NP_109385.1|NC_002682 266835.mll9510 WP_010916252.1.45716 gi|13488378|ref|NP_109385.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]