SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|146344359|ref|YP_001202215.1|NC_009444 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|146344359|ref|YP_001202215.1|NC_009444
Domain Number 1 Region: 122-308
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 5.62e-37
Family Methylesterase CheB, C-terminal domain 0.00058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|146344359|ref|YP_001202215.1|NC_009444
Sequence length 311
Comment putative transcriptional regulator methylesterase [Pseudomonas fluorescens SBW25 plasmid pQBR103]
Sequence
MRVGVVSTDEVQKALFTELLAPLVGDLIMYDVSHAKDGDLEISNAHILLIDMADSNVVEC
EEVMEALGREEPICLVHDKNLYAMAQRDRISWRNRTIEEIKLALPDLANELDEKKDEADN
KNVPDLWIIGASSGGPQALRQFFGDLPRMPISIFVAQHMSEAGYSQMLARLKDVAPGWGV
QSAESGMKIKPNSVYLVPRDNTIVINAGVIHLQPYSAQSVSFNPCIDAVIRSVFDCHPHL
GVIILSGMGMDGSGGIRTIKGKAKMIMAQDHESSGAKSMPDTARNTGAVQYSANPEGLAR
KLAQIYGQKTF
Download sequence
Identical sequences A0A0G4E657 A0A1T1IYD2 A4V7G5
WP_011923268.1.94976 gi|146344359|ref|YP_001202215.1|NC_009444 216595.pQBR0470

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]