SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|148550729|ref|YP_001260168.1|NC_009507 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148550729|ref|YP_001260168.1|NC_009507
Domain Number 1 Region: 6-135
Classification Level Classification E-value
Superfamily CheY-like 6.4e-31
Family CheY-related 0.00011
Further Details:      
 
Domain Number 2 Region: 132-197
Classification Level Classification E-value
Superfamily C-terminal effector domain of the bipartite response regulators 8.84e-17
Family GerE-like (LuxR/UhpA family of transcriptional regulators) 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|148550729|ref|YP_001260168.1|NC_009507
Sequence length 203
Comment two component LuxR family transcriptional regulator [Sphingomonas wittichii RW1 plasmid pSWIT01]
Sequence
MASDPIVYVIDDDDSVRHSLEFLLDVAGIRVRSYASADAFLKSSPPLAGACLVTDVRMPG
MTGIELAEKLQHGGAGVPVIVVTGHADVPLAIQAMKAGVADFIEKPFDDEVMLSAIRNAL
ARTAGDAASATERQAILDRIATLSPREREVMDGLVAGQANKAIAYDLEISARTVEVYRAN
VMMKMQAKTLSDLVRMVTIARLS
Download sequence
Identical sequences A5VGI5
WP_011950555.1.69875 392499.Swit_5293 gi|148550729|ref|YP_001260168.1|NC_009507 gi|148550729|ref|YP_001260168.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]