SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|148550791|ref|YP_001260230.1|NC_009507 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148550791|ref|YP_001260230.1|NC_009507
Domain Number 1 Region: 4-189
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 4.45e-54
Family Methylesterase CheB, C-terminal domain 0.0000514
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|148550791|ref|YP_001260230.1|NC_009507
Sequence length 191
Comment CheB methylesterase [Sphingomonas wittichii RW1 plasmid pSWIT01]
Sequence
MSRDPIRAVVIGASAGAVQVLLEILPALPPTFPVPIFIVVHIPPDRTNALTTLFADRCGL
TVKEAEDKETPVPGTVYFAPADYHLLIEQDGRVALAMDEPVHHSRPAIDVLFETAADAFG
PDLVAIVLTGANEDGAAGLRAVGEAGGLTLVEDPTSASSSTMPTAALAAWPQARAQDVPG
IIAYLQTLVAP
Download sequence
Identical sequences A5VGP7
392499.Swit_5355 gi|148550791|ref|YP_001260230.1|NC_009507 gi|148550791|ref|YP_001260230.1| WP_011950615.1.69875

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]