SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150376420|ref|YP_001313016.1|NC_009620 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150376420|ref|YP_001313016.1|NC_009620
Domain Number 1 Region: 276-470
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 1.42e-51
Family Chemotaxis receptor methyltransferase CheR, C-terminal domain 0.0005
Further Details:      
 
Domain Number 2 Region: 5-193
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 4.18e-48
Family Methylesterase CheB, C-terminal domain 0.00014
Further Details:      
 
Domain Number 3 Region: 711-831
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000000552
Family Flavin-binding PAS domain 0.091
Further Details:      
 
Domain Number 4 Region: 211-278
Classification Level Classification E-value
Superfamily Chemotaxis receptor methyltransferase CheR, N-terminal domain 0.00000000000157
Family Chemotaxis receptor methyltransferase CheR, N-terminal domain 0.013
Further Details:      
 
Domain Number 5 Region: 931-1025
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 0.0000782
Family Histidine kinase 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|150376420|ref|YP_001313016.1|NC_009620
Sequence length 1027
Comment putative PAS/PAC sensor protein [Sinorhizobium medicae WSM419 plasmid pSMED01]
Sequence
MTYEDNRFPIVGIGASAGGIPAMQGFFKGLPVNSNMAFVIVTHLSPEHESQLHEVVARYT
DLPVLVAEDGMAAQPNHVYVMPQNAILSIAGGHLRLRKPDAATRERKPIDIFLSTLAEDQ
GEQAVGIILSGGDSDGTLGAKAIKEHGGLTLAQASDGSGPRNPDMPQSAISSGVIDLAVT
AEEMGEKLIAYANGFMAAQDVATEETPDAREARSEIYGLLRRHSGHDFSGYKSKTFLRRV
RRRMQILQVRALPDYLKLLRRDPSEVTNLFRDLLINVTNFFRDQDAFKALEQLVIPRLFE
GRKAGEPVRVWVPGCATGEEVYSLGILMRERMEKLADMPRVQIFATDIDESALGVARAGR
YPEALLQGLSPERIARHFNCDGASFVISSDVRELCIFSPHSVTRDPPFSRMDLVSCRNLL
IYLDQETQKRVISTFHYALKPGGYLFLGTSESIGQHGEHFSTIDKKNRIFQARGHDAVPR
VPALVGPPKTVNTADGRIHGLRIGTYPLRQVVEAHVLERFAPAHVVVNADGEAVYYSART
GKYLEVPQGAPSRQILTTARRGLRLDLRAALREAASARKVVVRENALLEDDDDRVQRVNL
TVEPLADGAGGEPLYLVVFDPIGPLQSRAEAEHSGYDADTAAILESELRETRERLQSTIE
EYETALEELKSSHEELVSVNEEAQSTNEELEASKEEMQSLNEELSTINAELTAKVEELDR
ANSDLKNLFESMQIATVFLDRNLVIRNFTPAASSFFNIRPSDVGRPLTELSSKLDYPELK
EQIASVFKTGEAVEHHLARDQNGKHFLVRLIPYRDDAARVDGVVVTLVDVTKMAEAEAHQ
QMLVSELNHRVKNMLAVVISIANHSMQTARSPNEFNQALIGRLQAMGRAYGLLTETHWTA
APVDHLIRQEIEAFGTGRFEVNGPDIHLEPQQGLSIGMVIHELATNASKYGALSKSEGKV
LVGWQSANGVFRLTWQESDGPPVSEPEREGFGLSLLKGEIGYRLDGEVETFFRPEGLFVR
IAFPFER
Download sequence
Identical sequences A6UHF3
gi|150376420|ref|YP_001313016.1| gi|150376420|ref|YP_001313016.1|NC_009620 366394.Smed_4278 YP_001313016.1.44884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]