SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150377234|ref|YP_001313829.1|NC_009621 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150377234|ref|YP_001313829.1|NC_009621
Domain Number 1 Region: 156-341
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 1.96e-61
Family Methylesterase CheB, C-terminal domain 0.0000276
Further Details:      
 
Domain Number 2 Region: 1-107
Classification Level Classification E-value
Superfamily CheY-like 0.00000146
Family CheY-related 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|150377234|ref|YP_001313829.1|NC_009621
Sequence length 343
Comment response regulator receiver modulated CheB methylesterase [Sinorhizobium medicae WSM419 plasmid pSMED02]
Sequence
MVRILLVASTHEVEELVKKAIESDASAELLLTARSGKDAVRMTGELLPDIVAVELCPSGD
DSAKTVREIMISAPTPVVMLASRDGSQLGTASAQALEAGALAVIPAPGAHGTALDAPAIE
KFLSTVKAMSQVKIVRQWRRKDHGSKDRTAPAASAAIGIVAIAASTGGPAALRSILKEIS
ADFPVPILIVQHMSNGFIDGVAASLDATVPPTVKVARNGELLRPGTVYFAPDNYQLGVSG
RSRLRISDDAPVNGFKPSGSYLFGSIARVFKGESLAVILTGMGDDGTEGLRSLRVAGGKA
IAQDEKSSVVFGMPKSAIGAGLVDLVLPLESIAENITAIARGR
Download sequence
Identical sequences A6UJR6
gi|150377234|ref|YP_001313829.1| 366394.Smed_5119 YP_001313829.1.44884 gi|150377234|ref|YP_001313829.1|NC_009621

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]