SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150377819|ref|YP_001314414.1|NC_009621 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150377819|ref|YP_001314414.1|NC_009621
Domain Number 1 Region: 2-187
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 7.19e-54
Family Methylesterase CheB, C-terminal domain 0.0000486
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|150377819|ref|YP_001314414.1|NC_009621
Sequence length 351
Comment CheB methylesterase [Sinorhizobium medicae WSM419 plasmid pSMED02]
Sequence
MRDVIAIGGSLGAVAALKHLLGKLPGDFAAAVFVVIHVGAGGNDLLADIFDAHAEIPVTT
AVDGEHVEPGHVYVAPADHHLLVIDGIIRLGRGPRENLARPAVDPLFRSVGLNYGPRAIA
VVLTGMLNDGAAGLADVKRCGGLTVVQNPSDAVAPDMPMGALRASDVDHRAPLDGLAALL
IELTHEEAGPPIPVPTDIKLEVDIALGRQIGSEKMLNIADPVPISCPACGGVLSQIKSWP
PLRFRCQVGHAYTSEALVAESEGAVDEALRVALRIIEERVTLSEKMADDADHSGFAAAAA
AYRRRADEGREHAETLRYAIIGVASEATAGELEHDGRAAAKNPGHIDPESS
Download sequence
Identical sequences A6ULF1
gi|150377819|ref|YP_001314414.1|NC_009621 gi|150377819|ref|YP_001314414.1| 366394.Smed_5775 WP_011970589.1.89664 YP_001314414.1.44884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]