SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|158339625|ref|YP_001521014.1|NC_009926 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158339625|ref|YP_001521014.1|NC_009926
Domain Number 1 Region: 5-98
Classification Level Classification E-value
Superfamily SpoIIaa-like 1.1e-22
Family Anti-sigma factor antagonist SpoIIaa 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|158339625|ref|YP_001521014.1|NC_009926
Sequence length 107
Comment anti-sigma-factor antagonist [Acaryochloris marina MBIC11017 plasmid pREB1]
Sequence
MSYEVFQPADLMDGISANQLRSEINDALANGVKTILIDLRDVTFMNSSAIGSLVATLKSV
RGEDGTLSLCSLNDQVRIIFELTKMDHIFDIYADRQEFMHKNGISSS
Download sequence
Identical sequences A8ZL14
gi|158339625|ref|YP_001521014.1|NC_009926 gi|158339625|ref|YP_001521014.1| 329726.AM1_A0364 WP_012166856.1.67183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]