SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16264244|ref|NP_437036.1|NC_003078 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16264244|ref|NP_437036.1|NC_003078
Domain Number 1 Region: 7-190
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 2.22e-51
Family Methylesterase CheB, C-terminal domain 0.0003
Further Details:      
 
Domain Number 2 Region: 271-449
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 1.48e-45
Family Chemotaxis receptor methyltransferase CheR, C-terminal domain 0.00057
Further Details:      
 
Domain Number 3 Region: 827-955
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 5.53e-21
Family Heme-binding PAS domain 0.024
Further Details:      
 
Domain Number 4 Region: 198-273
Classification Level Classification E-value
Superfamily Chemotaxis receptor methyltransferase CheR, N-terminal domain 9.68e-16
Family Chemotaxis receptor methyltransferase CheR, N-terminal domain 0.0059
Further Details:      
 
Domain Number 5 Region: 734-836
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000646
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.074
Further Details:      
 
Domain Number 6 Region: 1042-1147
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 0.0000542
Family Histidine kinase 0.06
Further Details:      
 
Weak hits

Sequence:  gi|16264244|ref|NP_437036.1|NC_003078
Domain Number - Region: 604-725
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.000418
Family FCH domain 0.02
Further Details:      
 
Domain Number - Region: 508-608
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0725
Family Flavin-binding PAS domain 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|16264244|ref|NP_437036.1|NC_003078
Sequence length 1161
Comment chemotaxis methyltransferase [Sinorhizobium meliloti 1021 plasmid pSymB]
Sequence
MDRELDPPIVAIGASAGGVQALQTFFDLMPSDTGATFVVIVHLDPHARSELANILAARTR
MPVTQVEDQARLESNHVYVIAPNRRLKVADGTIAALPFEEPHALRAPIDLFFRSLAEEHG
SEFAVILTGAGADGAIGVKAVKEAGGIVLVQDPEEAEYASMPRNAIDTEVADFVLPIREL
PHRVAELLARRDQLPSHPFRADDDDMIGRILAHVRGRTGHDFSQYKRATILRRIGRRAQI
ARRETFADYYNYLRENPEEAQALFSDFLISVTTFFRDPSAFEALAERVIPQLFDGKEVAD
AIRVWIPGCATGEETYTMGMLLIEEAARRDLSPEIQVFGSDLDEQALRIAREGRYPSTIE
SDLSEERLRRFFQREGDHYRVRRELRDVVLFASHSLLRDPPFSHLDMISCRNLLIYLDRQ
LQQQVCNTFHYALNAGGFLFLGSSESADHPGLFLTVDREARIYRAVAGGGARRPMVLPAL
LGPQKPEMKSTIIRTPAAGHVSDAAVHRQMLEKIAPPSMLVDESHHAIHLSENAGRFLRP
SGGPVSTDATDLVREEFRFDVRAALHRAFERDEPTLSMPILADLDGQPHRVYLQVKPVVQ
GTERTRHALVLFIEGEAIDKTQEVVLDTLDGRPTIDEAIRRLQEELQLAQNRLRLTSEES
ATATEELRAANEELQSMNEEYRSTAEELETSKEELQSINEELQTVNNELKLKLESISRAH
SDLQNLMAATDIATLFLDPSLRIKRFTPRLTEIFNVTPSDEGRPITDFTHYLKYKRLSDD
ARAVLETLRPLEHEVKSRNDGWYLVRMRPYRTVEDKIDGVVVTFLDISERRHAEEAAKES
GRRLEQEMRLVELSRSPIFVWDFDDGIMQWNRGSEELYGYSREEAIGRRKEELLKTAVPG
SSFDRLRRTLSEKGRWSGELNHTTKDGRVLTVESQIELVPFGERRLVLESTRDITDRKRW
ERRGQLLLNELSHRVKNTLAVVQSLARQTLRTTRSSEDFVERFEGRLAALASAHKLLVDS
EWRGAELDALARGQLDAYAGSDRRRLQIEGEPVTLPPDLATPFGLVLHELATNAAKYGAF
STGNGQIRLSWKLGNNGRRLGVIWQERGGPPVEPPSEQGFGGVLIEKSLPGSTVHRDFQP
DGVVCTIDIELPEIRPDGAEN
Download sequence
Identical sequences Q92W49
gi|16264244|ref|NP_437036.1|NC_003078 gi|470185872|ref|YP_007613244.1|NC_020560 266834.SM_b20515 gi|470185872|ref|YP_007613244.1| gi|16264244|ref|NP_437036.1| NP_437036.1.96377 WP_010975376.1.4234 WP_010975376.1.787

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]