SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|17549622|ref|NP_522962.1|NC_003296 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|17549622|ref|NP_522962.1|NC_003296
Domain Number 1 Region: 185-373
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 1.23e-72
Family Methylesterase CheB, C-terminal domain 0.000000287
Further Details:      
 
Domain Number 2 Region: 6-111
Classification Level Classification E-value
Superfamily CheY-like 5.27e-27
Family CheY-related 0.0000091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|17549622|ref|NP_522962.1|NC_003296
Sequence length 381
Comment chemotaxis-specific methylesterase [Ralstonia solanacearum GMI1000 plasmid pGMI1000MP]
Sequence
MNEKRKIQVLCIDDSALIRSILKEIINAQPDMEVVGVAPDPIIARDLIKQTNPDVLTLDV
EMPKMDGLDFLEKLMRLRPTPVVMISSLTERGSEATLRALELGAVDFVAKPKLGMRDGMN
EYADQIADKIRAAARARLRPRTASPAPAPAAASPAHAVHTAHAVHARPEHDAAAVPAPAR
THFSSTEKLIIVGASTGGTEAIKDFLLEMPPDCPGILIVQHMPAGFTTSFAKRLDGLCRI
RVKEAVHGERVLPGHAYIAPGDMHLSLGRSGANYVTELDQNPPVNRHRPAVDVLFRSAAR
NAGANALGVILTGMGKDGAAGMLEMRNAGAYNVAQDEASCVVYGMPKEAVAHGGVHEILP
LHQIGPHVLARLSAHGRVTRV
Download sequence
Identical sequences A0A223GWJ2 Q8XQ83
gi|17549622|ref|NP_522962.1| gi|17549622|ref|NP_522962.1|NC_003296 267608.RSp1403 WP_011004653.1.81933

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]